Align MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)
to candidate WP_010438520.1 G7G_RS0103685 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= TCDB::Q9X103 (369 letters) >NCBI__GCF_000192475.1:WP_010438520.1 Length = 365 Score = 342 bits (878), Expect = 7e-99 Identities = 181/363 (49%), Positives = 253/363 (69%), Gaps = 16/363 (4%) Query: 10 NVTKVYEN--KVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITDGKIYIDG 67 ++ K+Y+N V +K+ N+ +E +F+VL+GPSGCGK+T L IAGLEEIT G + I G Sbjct: 6 DINKLYKNYGPVEILKDINISIEPGDFLVLVGPSGCGKSTLLNCIAGLEEITGGTLSIGG 65 Query: 68 KVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREAAKILGIE 127 + V PKDRDIAMVFQ+YALYP M+V +N+ FG+K+R + D +++E A +L IE Sbjct: 66 NDMTHVSPKDRDIAMVFQSYALYPTMSVAKNITFGMKVRGVDQATQDAKLKEVASLLQIE 125 Query: 128 NLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELKKLHHRLQ 187 LL+R+P QLSGGQRQRVA+GRA+VR+PK+FLFDEPLSNLDAKLRV+MR+E+KKLH L Sbjct: 126 PLLNRRPSQLSGGQRQRVAMGRALVRDPKLFLFDEPLSNLDAKLRVEMRTEIKKLHQTLD 185 Query: 188 ATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFIGSPPMNFVNA 247 A+I+YVTHDQ+EAMT+A KIVV+K G +QQIGTP EIYN+PAN+FVA F+GSP MN + A Sbjct: 186 ASIVYVTHDQIEAMTLATKIVVLKGGIVQQIGTPAEIYNNPANLFVADFMGSPAMNLIPA 245 Query: 248 RVVRGEGGLWIQASGFKVKVPKEFEDKL------ANYIDKEIIFGIRPEDIYDKLFALAP 301 + SG ++ + +E D L A + +++I G+RPEDI + F Sbjct: 246 QASN-------NGSGTQISITRETGDTLVLTDARAPELPQDVILGLRPEDIAEAGFRAGA 298 Query: 302 SPENTITGVVDVVEPLGSETILHVKVGDDLIVASVNPRTQAKEEQKIDLVLDMTRMHAFD 361 + +VD+VEP G++T + ++G + A ++ T A+ Q ++L DM+++ F Sbjct: 299 GVQEAAC-MVDMVEPAGADTYVVSELGGKQVTARLHAETSAQAGQMLNLAFDMSKVSYFA 357 Query: 362 KET 364 KET Sbjct: 358 KET 360 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 365 Length adjustment: 30 Effective length of query: 339 Effective length of database: 335 Effective search space: 113565 Effective search space used: 113565 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory