Align 2-keto-4-pentenoate hydratase 3; EC 4.2.1.80; 2-hydroxypentadienoic acid hydratase 3 (uncharacterized)
to candidate WP_010441603.1 G7G_RS0111655 2-oxo-hepta-3-ene-1,7-dioic acid hydratase
Query= curated2:Q706S1 (269 letters) >NCBI__GCF_000192475.1:WP_010441603.1 Length = 266 Score = 174 bits (442), Expect = 1e-48 Identities = 103/265 (38%), Positives = 143/265 (53%), Gaps = 6/265 (2%) Query: 1 MTPQQREEAAQSLYQAMQSGKPIAPLRDTFPDMNVDDAYAIQSINTQRRISLGRRVVGRK 60 MTP + +AA L A +SG I L P+M +DDAY +Q+ + +++ GR VVG K Sbjct: 1 MTPAEHAKAAADLLDAERSGNQIGLLSLRHPEMGMDDAYEVQNAIYRAKLAEGRSVVGWK 60 Query: 61 IGLTSVVVQQQLGVDEPDFGALFDDMSFGDAETIPLSILHQPKVEAEIGFVLGRDLDTEQ 120 IGLTS +Q L +D PD G LFDDM F + T+P QP++EAEI FV L + Sbjct: 61 IGLTSKAMQYALNIDIPDSGILFDDMIFDNGATVPADRFIQPRIEAEIAFVTKSPLGGDN 120 Query: 121 PTHQEVLQAVDYVVPALEIVGSRIADWNIK------FVDTVADNASSGVYVLGSTPISPR 174 + ++V+ A DYV PA+EI+ +RI + + DT++DNA++ VLG+ Sbjct: 121 VSREDVIAATDYVAPAIEILDTRIQRVDPETGKTRTVFDTISDNAANAGIVLGAARHKID 180 Query: 175 GLDLSLVGMCLSRRGEPVSTGAGAACLGTPLNAVVWLARTMSRLGKPLRAGELILSGALG 234 DL VG R GE TG GA L P+ +VVWLAR M+ G+ + G++ILSG+ Sbjct: 181 AADLRWVGALTFRNGEIEETGLGAGVLNDPIESVVWLARRMATYGQSIEPGQIILSGSFI 240 Query: 235 PMVAVKPGDVFECHINGVGSVRTEF 259 V G GSV F Sbjct: 241 RPVECPSGTEIHADFGAFGSVDIRF 265 Lambda K H 0.318 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 266 Length adjustment: 25 Effective length of query: 244 Effective length of database: 241 Effective search space: 58804 Effective search space used: 58804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory