Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate WP_010438474.1 G7G_RS0103600 betaine-aldehyde dehydrogenase
Query= metacyc::MONOMER-15108 (486 letters) >NCBI__GCF_000192475.1:WP_010438474.1 Length = 484 Score = 343 bits (879), Expect = 1e-98 Identities = 177/474 (37%), Positives = 271/474 (57%), Gaps = 5/474 (1%) Query: 13 HFIDGKFVPSLDGKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKALNGPWKKMTANE 72 HFI+G++V G D I PAT E + + ++ A+ +AK A W M+ E Sbjct: 9 HFINGEYVEDTRGTPIDVIYPATGEVIARLHSATPEIVEQALNSAKSA-QASWAAMSGTE 67 Query: 73 RIAVLRKVGDLILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHFFSDYIRTITNEA 132 R VLR+ D++ +R LS+LE+ DTGKP + D A +F ++T E Sbjct: 68 RGRVLRRASDIMRDRNRALSILETHDTGKPLQETLVADATSGADALEYFGSLAASLTGEH 127 Query: 133 TQMDDVALNYAIRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVMKPAELTPMTATV 192 + Y IR +GV I WN P + WK APALA GN +V KP+E TP++A Sbjct: 128 IPLGGGDFVYTIREALGVCVGIGAWNYPTQIACWKGAPALACGNAMVFKPSETTPLSALQ 187 Query: 193 LAEICRDAGVPDGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTGKIIMASAAKTLK 252 +AEI +AG P G+ N+V G+G GA+L P V +S TG TG+ + A+AA +K Sbjct: 188 VAEILIEAGAPKGIYNVVQGYG--DVGASLVTDPRVAKVSLTGSVPTGRKVYAAAADGMK 245 Query: 253 RLSYELGGKNPNVIFADSNLDEVIETTMKSSFINQGEVCLCGSRIYVERPAYEAFLEKFV 312 ++ ELGGK+P ++F D++LD + + +F + G+VC G+R++V++ EAFL + Sbjct: 246 HVTMELGGKSPMIVFDDADLDNAVSGAILGNFYSSGQVCSNGTRVFVQKGIKEAFLSRLS 305 Query: 313 AKTKELVVGDPFDAKTKVGALISDEHYERVTGYIKLAVEEGGTILTGGKRPEGLEKGYFL 372 + +GDP D + G ++S+ GY++ EG ++ GG R G G+++ Sbjct: 306 DRLATAKIGDPLDEEVNFGPMVSENQMNIALGYVEKGKAEGARLVYGGVRIAG--DGFYM 363 Query: 373 EPTIITGLTRDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGLSASVWTNDLRRAHR 432 +PT+ +T D + +EEIFGPV++V+ F+TEEEVL + NDT +GL+A V+TNDL RAHR Sbjct: 364 QPTVFADVTDDMTIAREEIFGPVMSVLDFETEEEVLARANDTEFGLAAGVFTNDLTRAHR 423 Query: 433 VAGQIEAGIVWVNTWFLRDLRTPFGGMKQSGIGREGGLHSFEFYSELTNICIKL 486 + EAG ++NT+ L + PFGG K SG+GRE + +SE+ + + + Sbjct: 424 IVAGFEAGTCYINTYNLAPVEAPFGGSKMSGVGRENSKLAINHFSEMKTVYVSM 477 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 592 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 484 Length adjustment: 34 Effective length of query: 452 Effective length of database: 450 Effective search space: 203400 Effective search space used: 203400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory