Align ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized)
to candidate WP_010438517.1 G7G_RS0103680 carbohydrate ABC transporter permease
Query= reanno::WCS417:GFF4322 (281 letters) >NCBI__GCF_000192475.1:WP_010438517.1 Length = 299 Score = 354 bits (909), Expect = e-102 Identities = 177/277 (63%), Positives = 214/277 (77%), Gaps = 9/277 (3%) Query: 14 RIAIYAVLILAVLLYLVPLVVMLLTSFKTPEDISSGNLLSWPTVVTGIGWVKAWATV--- 70 R +Y +L L L YL+PL VML TS K+ E+I +G+L+S P V+ W AW+ Sbjct: 23 RWLLYVLLGLFALYYLMPLFVMLTTSLKSLEEIRTGSLISLPREVSFDAWKTAWSGACTG 82 Query: 71 ---DG---YFWNSIKITVPAVLISTAIGALNGYVLSFWRFKGSQLFFGLLLFGCFLPFQT 124 +G YFWNS+ I VPAV IST +GALNGYV++ WRFKG+ + F L+LFGCF+PFQ Sbjct: 83 IQCEGLRPYFWNSVLIAVPAVAISTLLGALNGYVVAQWRFKGANIIFSLMLFGCFIPFQV 142 Query: 125 VLLPASFTLGKMGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALIKAARLDGAGFF 184 VLLP + LG MG+A T GL+FVHV+YGL FTTLFFRNYYV+IP L KAAR+DGAGF Sbjct: 143 VLLPMARLLGIMGIAGTIPGLIFVHVIYGLGFTTLFFRNYYVTIPAELTKAARVDGAGFM 202 Query: 185 TIFRQIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTSTGAKE 244 IF I LP+S PII+V +IWQFTQIWNDFLFGV FS +QP+TVALNN+VN++TG KE Sbjct: 203 RIFWSIFLPLSLPIIVVTVIWQFTQIWNDFLFGVSFSQAGTQPVTVALNNIVNSTTGVKE 262 Query: 245 YNVDMAAAMIAGLPTLLVYVIAGKYFVRGLTAGAVKG 281 YNVDMAAA+IAGLPTLLVYV+AGKYF+RGLTAG+VKG Sbjct: 263 YNVDMAAAIIAGLPTLLVYVVAGKYFIRGLTAGSVKG 299 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 299 Length adjustment: 26 Effective length of query: 255 Effective length of database: 273 Effective search space: 69615 Effective search space used: 69615 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory