Align ABC transporter for D-Glucose-6-Phosphate, permease component 1 (characterized)
to candidate WP_120981191.1 G7G_RS0117195 carbohydrate ABC transporter permease
Query= reanno::WCS417:GFF4322 (281 letters) >NCBI__GCF_000192475.1:WP_120981191.1 Length = 313 Score = 284 bits (726), Expect = 2e-81 Identities = 140/287 (48%), Positives = 200/287 (69%), Gaps = 11/287 (3%) Query: 6 SKPAISLSR--IAIYAVLILAVLLYLVPLVVMLLTSFKTPEDISSGNLLSWPTVVTGIGW 63 SKP LSR I +Y L+L + YL+PL VM++TS K +I GN+ + P +T W Sbjct: 27 SKPKSRLSRRNIFLYGTLLLVSIYYLLPLYVMIVTSLKGMPEIRLGNIFAPPVEITFEPW 86 Query: 64 VKAWATV------DGY---FWNSIKITVPAVLISTAIGALNGYVLSFWRFKGSQLFFGLL 114 VKAWA DG F NS+KI +P++++S +I ++NGY L+ WRFKGS++FF +L Sbjct: 87 VKAWAEACTGINCDGLSRGFGNSVKILIPSLILSISIASVNGYALANWRFKGSEVFFTIL 146 Query: 115 LFGCFLPFQTVLLPASFTLGKMGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALIK 174 + G F+P+QT+L P L ++GL + GLV VH V+G+ TL FRNY+ S+P+ L K Sbjct: 147 IIGAFIPYQTMLYPIVIILREIGLMGSLWGLVLVHTVFGMPILTLLFRNYFTSLPEELFK 206 Query: 175 AARLDGAGFFTIFRQIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNN 234 AAR+DGAGF+ ++ +++LPMS PI +V +I Q T IWNDFLFGV+++ ++ P+TV LNN Sbjct: 207 AARVDGAGFWGVYFRVMLPMSIPIFVVAMILQVTGIWNDFLFGVIYTKPETYPMTVQLNN 266 Query: 235 LVNTSTGAKEYNVDMAAAMIAGLPTLLVYVIAGKYFVRGLTAGAVKG 281 +VN+ G KEYNV+MAA ++ GL L++Y ++GK FVRG+ AGAVKG Sbjct: 267 IVNSVQGIKEYNVNMAATLLTGLVPLVIYFVSGKLFVRGIAAGAVKG 313 Lambda K H 0.328 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 313 Length adjustment: 26 Effective length of query: 255 Effective length of database: 287 Effective search space: 73185 Effective search space used: 73185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory