Align BadH (characterized)
to candidate WP_009125517.1 HMPREF9446_RS09995 gluconate 5-dehydrogenase
Query= metacyc::MONOMER-893 (255 letters) >NCBI__GCF_000195635.1:WP_009125517.1 Length = 267 Score = 139 bits (350), Expect = 6e-38 Identities = 83/253 (32%), Positives = 129/253 (50%), Gaps = 8/253 (3%) Query: 4 LQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRCD 63 L+ K A++TG GIG A +A++GA I D+N + +K A G A CD Sbjct: 9 LEGKVALVTGASYGIGFAIASAYAEQGATICFNDINQELVDKGMAAYTAKGIKAHGYVCD 68 Query: 64 IADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMHH 123 + + +V A +AT +G +DILVNNAG P + E ++ R+I I+L + Sbjct: 69 VTNEPAVQAMVATIEKEVGTIDILVNNAGIIRRVPMHEMEAADFRRVIDIDLNAPFIVSK 128 Query: 124 AVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNVV 183 AVLP M+++ HG+I+NI S + +G + YAA KGGL ++ + E+ + I N + Sbjct: 129 AVLPAMMKKGHGKIINICSMMSELGRETVSAYAAAKGGLKMLTRNICSEYGEYNIQCNGI 188 Query: 184 CPG----PTDTALLADVTSGAANPEKLIEAFTKA-IPLGRLGKPDDLAGAIAFFGSDDAG 238 PG P L G+ +P ++F A P GR P++L G F S+ + Sbjct: 189 GPGYIATPQTAPLREKQADGSRHP---FDSFICAKTPAGRWLDPEELTGPAVFLASEASN 245 Query: 239 FITGQVLSVSGGL 251 + G +L V GG+ Sbjct: 246 AVNGHILYVDGGI 258 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 267 Length adjustment: 25 Effective length of query: 230 Effective length of database: 242 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory