Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate WP_009126569.1 HMPREF9446_RS14965 AMP-binding protein
Query= BRENDA::A4YDT1 (564 letters) >NCBI__GCF_000195635.1:WP_009126569.1 Length = 551 Score = 350 bits (899), Expect = e-101 Identities = 206/528 (39%), Positives = 310/528 (58%), Gaps = 20/528 (3%) Query: 38 FNWVRDVFEDIHVKERGSKTALIWRDINTGEEAKLSYHELSLMSNRVLSTLRKHGLKKGD 97 FN+ DV D + K AL+W + + GE + ++ ++ ++ S + G+ +GD Sbjct: 29 FNFGYDVV-DAWAEAEPDKPALLWTN-DKGEHRQFTFADMKRYTDMTASYFQSLGIGRGD 86 Query: 98 VVYLMTKVHPMHWAVFLAVIKGGFVMVPSATNLTVAEMKYRFS--DLKP-----SAIISD 150 +V L+ K W +A+ K G V++P+ LT ++ YR + D+K ++I+D Sbjct: 87 MVMLILKRRFEFWFSIVALHKLGAVVIPATHLLTKKDIVYRCNAADIKMIVCAGESVITD 146 Query: 151 SLRASVMEEALGS--LKVEKFLIDGKRETWNSLEDESSNAEPEDTR-GEDVIINYFTSGT 207 + A++ E + V + +G + + + +PE +D+ + YFTSGT Sbjct: 147 HITAAMPESPTVRKLVSVGPEIAEGFEDFHKGIGTAAPFVKPEQPNTNDDISLMYFTSGT 206 Query: 208 TGMPKRVIHTAVSYPVGSITTASIV-GVRESDLHLNLSATGWAKFAWSSFFSPLLVGATV 266 TG PK V H +YP+G I T S + E LHL ++ TGW K W + + GA V Sbjct: 207 TGEPKMVAHD-FTYPLGHIVTGSFWHNLTEESLHLTIADTGWGKAVWGKLYGQWIAGANV 265 Query: 267 VGINYEGKLDTRRYLGEVENLGVTSFCAPPTAWRQFITLDLDQFRFERLRSVVSAGEPLN 326 ++E K L ++++ VTS CAPPT +R I DL ++ L+ AGE LN Sbjct: 266 FVYDHE-KFTPADILEKIQDYHVTSLCAPPTIFRFLIHEDLTKYNLSSLKYCTIAGEALN 324 Query: 327 PEVIKIWKDKFNLTIRDFYGQTETTAMVGNFPFLKVKPGSMGKPHPLYDIRLLDDEGKEI 386 P V + +K + + + +GQTETT V P+++ KPGSMG P+P YD+ L+D +G+ + Sbjct: 325 PAVFETFKKLTGIKLMEGFGQTETTLTVATMPWMEPKPGSMGLPNPQYDVDLIDYDGRSV 384 Query: 387 TKPYEVGHITVKLNP-RPIGLFLGY-SDEKKNMESFREGYYYTGDKAYFDEEGYFYFVGR 444 + E G I ++ + +P+GLF Y D + E++ +G YYTGD A+ DE+GY +FVGR Sbjct: 385 -EAGEQGQIVIRTDKGKPLGLFKEYYRDANRTHEAWHDGIYYTGDVAWKDEDGYLWFVGR 443 Query: 445 GDDVIKTSDYRVGPFEVESALLEHPAVAEAAVVGVPDTVRWQLVKAYIVLKKGY--MPSK 502 DDVIK+S YR+GPFEVESAL+ HPAV E A+ GVPD +R Q+VKA IVL K Y + Sbjct: 444 ADDVIKSSGYRIGPFEVESALMTHPAVVECAITGVPDEIRGQVVKATIVLAKDYKERAGE 503 Query: 503 ELAEEIREKMKTLLSPYKVPRIIEFVDELPKTISGKIRRVELRKREEE 550 L +E++ +K + +PYK PR+IEFVDELPKTISGKIRRVE+RK +E+ Sbjct: 504 GLIKELQNHVKKVTAPYKYPRVIEFVDELPKTISGKIRRVEIRKNDEK 551 Lambda K H 0.318 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 824 Number of extensions: 38 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 564 Length of database: 551 Length adjustment: 36 Effective length of query: 528 Effective length of database: 515 Effective search space: 271920 Effective search space used: 271920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory