Align The aerobic dicarboxylate (succinate (Km, 30 μM), fumarate (Km, 79 (characterized)
to candidate WP_009124140.1 HMPREF9446_RS04025 SLC13/DASS family transporter
Query= TCDB::A4QAL6 (527 letters) >NCBI__GCF_000195635.1:WP_009124140.1 Length = 504 Score = 190 bits (483), Expect = 9e-53 Identities = 136/457 (29%), Positives = 226/457 (49%), Gaps = 56/457 (12%) Query: 77 AVTILMAVWWMTEAIPLAATALIPLVAF-------------------PAFQVVDFGKAAA 117 ++ + + W+ EA+P T+++ +V Q V + Sbjct: 67 SIFVFATLMWVFEAVPAWTTSVLIVVLLLLTVSDSSLWFFRQGYSSEELGQAVKYKSIMH 126 Query: 118 PYANPTIFLFLGGFLMALGLQKWNLHRRMALAVVLAVGTKPKQLVLGFMVATGFLSMWVS 177 +A+P I LF+GGF++A+ K L +A ++ GT+ + ++LGF++ T F SM++S Sbjct: 127 CFADPIIMLFIGGFILAIAATKSGLDVLLARVMLKPFGTQSRYVLLGFILVTAFFSMFLS 186 Query: 178 NTATAVVMLPIGMSVL-ALTAETVGGMKNQKKFATGLMLSIAYSASIGSLGTLIGTPPNA 236 NTATA +ML VL AL A+ G + GL L+I +A++G +GT IGTPPNA Sbjct: 187 NTATAAMMLTFLTPVLKALPADGKGKI--------GLALAIPVAANVGGMGTPIGTPPNA 238 Query: 237 LLAAYMS--ESHDIHIGFGQWMILGVPIAVVFTIIAWLVLTTVFKPEMKEIPGGRELIKR 294 + Y++ E +++IGFG+WM +P ++ IAW +L +F + K I ++ Sbjct: 239 IALKYLNDPEGLNMNIGFGEWMSFMMPYTIIVLFIAWFILLRLFPFKQKTIE-----LQI 293 Query: 295 EIAEMGPWTAPQVTVGVIFAAAALAWVFIPLTLDWTGSQLSINDSLIGIAAGLLMFIVPA 354 E W + + V + FA L W+ +D G+ + ++ I A Sbjct: 294 EGEAKKDWRS--IVVYITFAITVLLWM---------------SDKFTGVNSNVVAMIPVA 336 Query: 355 NFK-TGERILDWRTAGELPWDVLLLFGGGLSLSAMFTSTGLSLWIGELAKGLDALPIFIL 413 F TG ++ R E+ W VL + GG +L TGL+ + E P+ ++ Sbjct: 337 VFCITG--VITKRDLEEISWSVLWMVAGGFALGVALNETGLAKHMIEAIPFNTWSPV-VM 393 Query: 414 IFAIAVLVLFLTEFTSNTATAATFLPIMGGVAVGIGLTAGGEQNVLLLTIPVALSATCAF 473 I ++ + F S+TATAA +PI+ + + T VL L + VAL ++ A Sbjct: 394 IVGSGLICYAMANFISHTATAALLVPILAIAGISMRDTLQPMGGVLTLLVGVALGSSLAM 453 Query: 474 MLPVATPPNAIAFGSGYIKIGEMVKGGLWLNIIAVIL 510 +LP++TPPNA+A +G IK +M K GL + I ++L Sbjct: 454 VLPISTPPNALAHATGMIKQKDMEKVGLIMGAIGLVL 490 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 739 Number of extensions: 39 Number of successful extensions: 11 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 527 Length of database: 504 Length adjustment: 35 Effective length of query: 492 Effective length of database: 469 Effective search space: 230748 Effective search space used: 230748 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory