Align 2-Deoxy-D-ribose porter, DeoP (characterized)
to candidate WP_009124055.1 HMPREF9446_RS03580 L-fucose:H+ symporter permease
Query= TCDB::Q8XEV7 (438 letters) >NCBI__GCF_000195635.1:WP_009124055.1 Length = 439 Score = 206 bits (524), Expect = 1e-57 Identities = 130/419 (31%), Positives = 221/419 (52%), Gaps = 24/419 (5%) Query: 19 LFQFILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALVQSAFYGGYFLIAIPASLV 78 L FIL++ F LWG A + + ++ F +F +S ALVQ AFYGGYF +A PA++ Sbjct: 18 LIPFILITSCFALWGFANDITNPMVKAFSKIFRMSVTDGALVQVAFYGGYFAMAFPAAMF 77 Query: 79 IKKTSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFAIAIGLSFLETAANTYSSM 138 I+K SYK +L+GL LY +G LFFPA +Y FL A F + GLSFLET++N Y Sbjct: 78 IRKYSYKAGVLLGLGLYALGAFLFFPAMLTGSYYPFLIAYFVLTCGLSFLETSSNPYILS 137 Query: 139 IGPKAYATLRLNISQTFYPIGAAAGILLGKYLVFSEGESLE----KQMAGMNAEQVHNFK 194 +G + AT RLN++Q+F P+G+ G+ + + + ++ Q+A + E V + Sbjct: 138 MGTEETATRRLNLAQSFNPMGSLLGMYVAMNFIQNRLNPMDTVERSQLAAADFEAVRDSD 197 Query: 195 VLMLENTLEPYKYMIMVLVVVMVLFLLTRFPTCKVAQTASHKRPSALDTLRYLASNARFR 254 + +L Y+++ ++V+++LFL+ K A SH+ TL+ + +R Sbjct: 198 LSVLIG-----PYLVIGIIVLLMLFLIRMVKMPKNAD-QSHE-IDFFPTLKRIFRIKHYR 250 Query: 255 RGIVAQFLYVGMQVAVWSFTIRLA--LELGDINERDAS-----TFMVYSFACFFIGKFIA 307 G++AQF YVG Q+ W+F I+ L + D E A+ + + + F +FI Sbjct: 251 EGVIAQFFYVGAQIMCWTFIIQYGTRLFMADGMEEKAAEVLSQEYNIIAMIIFCCSRFIC 310 Query: 308 NILMTRFNPEKVLILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCWATIYAGTLDT 367 ++ +P +L + +++ L V + +Y V VS + TIY L Sbjct: 311 TFILRYLSPGLLLKVLAIVACLLTGGVIGFQNIWGMYCLVGVSACMSLMFPTIYGIALQG 370 Query: 368 VDNEHTEMAGAVIVMAIVGAAVVPAIQGYVADM-----FHSLQLSFLVSMLCFVYVGVY 421 + ++ + A ++MAI+G +V+P +Q + D ++ LSF++ ++CFV + +Y Sbjct: 371 LGDD-AKFGAAGLIMAILGGSVLPPLQASIIDQHTLLGMPAVNLSFILPLICFVVITIY 428 Lambda K H 0.329 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 439 Length adjustment: 32 Effective length of query: 406 Effective length of database: 407 Effective search space: 165242 Effective search space used: 165242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory