Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_009124498.1 HMPREF9446_RS05690 NADP-dependent malic enzyme
Query= curated2:Q59330 (328 letters) >NCBI__GCF_000195635.1:WP_009124498.1 Length = 762 Score = 161 bits (407), Expect = 6e-44 Identities = 104/332 (31%), Positives = 173/332 (52%), Gaps = 14/332 (4%) Query: 3 IIQSIIEKAKSNKKKIVLPEGAEPRTLKAADIVLKEGIADLVLLGNADEIRNAAEGLDIS 62 + + + + A+ N +++V EG P LKAA EGI ++LGN + I A+ LD+S Sbjct: 429 LTRQLYDTARRNPQRVVFAEGIHPNMLKAAVEAKAEGICHPIILGNDEAIEKLAKELDLS 488 Query: 63 KA--EIID---PLKSEKFDKYATDFYELRKNKGITLEKAKETIKDNIYFGCMMVKEGYAD 117 EI++ P ++ + ++YA E R +G T E+A + + + YFG MMV+ G AD Sbjct: 489 LEGIEIVNLRHPDEAPRRERYARILSEKRAREGATYEEANDKMFERNYFGMMMVETGEAD 548 Query: 118 GLVSGAIHATADLLRPAFQIVKTAPGAKIVSSFFIMEVPNCEFGENGVFLFADCAVNPSP 177 ++G ++ ++ A +++ P K + I+ + G F AD +N P Sbjct: 549 AFITGLYTKYSNTIKVAKEVIGIRPEYKHFGTMHILN------SKKGTFFLADTLINRHP 602 Query: 178 NAEELASIAVQSANTAKTLLGMEPRVAMLSFSTKGSASHELVDKVRTATEIAKNLIPDVA 237 NA L IA S +T + P +AMLS+S G+ V A + + P++A Sbjct: 603 NAATLIDIAKLSEHTVR-FFNHTPVMAMLSYSNFGADKEGSPVSVHEAVDYMQQNYPELA 661 Query: 238 IDGELQLDAALVKEVAELKAPGSPVAGR-ANVLIFPDLQAGNIGYKLVQRL-AKANAIGP 295 IDGE+Q++ A+ +E+ + K P + + G+ N LIFP+L + N YKL+Q + A IGP Sbjct: 662 IDGEMQVNFAMNREMRDAKYPFTRLKGKDVNTLIFPNLSSANSAYKLLQAMDTDAELIGP 721 Query: 296 ITQGMGAPVNDLSRGCSYKDIVDVIATTAVQA 327 I G+ P++ S +DIV++ A + A Sbjct: 722 IQMGLNKPIHFTDFESSVRDIVNITAVAVIDA 753 Lambda K H 0.315 0.133 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 762 Length adjustment: 34 Effective length of query: 294 Effective length of database: 728 Effective search space: 214032 Effective search space used: 214032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory