Align Mannokinase (EC 2.7.1.7) (characterized)
to candidate WP_039969159.1 HMPREF9446_RS10780 ROK family protein
Query= reanno::Smeli:SMc03109 (298 letters) >NCBI__GCF_000195635.1:WP_039969159.1 Length = 274 Score = 77.0 bits (188), Expect = 4e-19 Identities = 68/253 (26%), Positives = 103/253 (40%), Gaps = 28/253 (11%) Query: 1 MFIGIDWGGTKMEVIALDRDGETRARHRVPTPTSGYEDCIRAVVELVASAESTAGER-GS 59 M + ID GGT + V ++ E R +V P +D + +L S E+ Sbjct: 1 MKLSIDLGGTNIRVAQVE---EGRCLSKVSVPCLAQQDAPIVLDQLFQLVRSMMNEQVDG 57 Query: 60 IGIGIPGSPNPRTGIVRN-SNAVLINGKPLGRDLAAALGREVRLANDANCLAVSEAVDGA 118 IGIG+P + GIV N +N L L V + ND+NC A+ E++ G Sbjct: 58 IGIGVPSIVDSEKGIVYNVANISSWKEIRLKEILENEFNVAVAINNDSNCFALGESLYGE 117 Query: 119 GKDAGVVFGVIVGTGHGGGLAIGKKVHAGYQGVAAEIGHYPLPWMTKDEYPGHRCWCGKL 178 GK + GV +GTG G G+ IG++++ G A EIG +P + Y Sbjct: 118 GKPYDNMVGVTIGTGIGAGVIIGRRLYGGQFMGAGEIGSFPYLDADFERY---------- 167 Query: 179 GCLDMYACGTGLELDYRMTTGTDRRGRDIIEAKRAGDPVAIGVYGRFVDRLARSLALLTN 238 C + D G E R G+ A+ ++ F L + ++ Sbjct: 168 -CSSFF------------FKRHDTTGAAAAENARQGEQAALDIWKEFGMHLGNLVKVILF 214 Query: 239 IVDPDVFVLGGGM 251 P VLGGG+ Sbjct: 215 AYAPQAIVLGGGI 227 Lambda K H 0.319 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 172 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 274 Length adjustment: 26 Effective length of query: 272 Effective length of database: 248 Effective search space: 67456 Effective search space used: 67456 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory