Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate WP_009125517.1 HMPREF9446_RS09995 gluconate 5-dehydrogenase
Query= SwissProt::Q6CEE9 (278 letters) >NCBI__GCF_000195635.1:WP_009125517.1 Length = 267 Score = 131 bits (330), Expect = 1e-35 Identities = 88/259 (33%), Positives = 137/259 (52%), Gaps = 21/259 (8%) Query: 29 FSLKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEKAEYLSKTYGVRSKAYK 88 FSL+GKVA +TG+S GIGFA+A A+A+ GA + ++ +K G+++ Y Sbjct: 7 FSLEGKVALVTGASYGIGFAIASAYAEQGATICFNDINQELVDKGMAAYTAKGIKAHGYV 66 Query: 89 CAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNE----EWDKVVDLDL 144 C VTN V+ + TIEK+ G IDI + NAGI + VP +E ++ +V+D+DL Sbjct: 67 CDVTNEPAVQAMVATIEKEVGTIDILVNNAGI------IRRVPMHEMEAADFRRVIDIDL 120 Query: 145 NGAYYCAKYAGQIFKKQGYGSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAVEW 204 N + +K K+G+G I SM + + + Y AAK + L+R++ E+ Sbjct: 121 NAPFIVSKAVLPAMMKKGHGKIINICSMMSELGR--ETVSAYAAAKGGLKMLTRNICSEY 178 Query: 205 AGF-ARCNTVSPGYMAT----EISDFIPRDTKEKWWQLI----PMGREGDPSELAGAYIY 255 + +CN + PGY+AT + + ++ + I P GR DP EL G ++ Sbjct: 179 GEYNIQCNGIGPGYIATPQTAPLREKQADGSRHPFDSFICAKTPAGRWLDPEELTGPAVF 238 Query: 256 LASDASTYTTGADILVDGG 274 LAS+AS G + VDGG Sbjct: 239 LASEASNAVNGHILYVDGG 257 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 215 Number of extensions: 6 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 267 Length adjustment: 25 Effective length of query: 253 Effective length of database: 242 Effective search space: 61226 Effective search space used: 61226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory