Align L-rhamnose-1-dehydrogenase ( EC 1.1.1.173) (characterized)
to candidate WP_009124819.1 HMPREF9446_RS06870 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS28235 (260 letters) >NCBI__GCF_000195635.1:WP_009124819.1 Length = 248 Score = 106 bits (265), Expect = 4e-28 Identities = 77/254 (30%), Positives = 123/254 (48%), Gaps = 18/254 (7%) Query: 3 LKDKVVIVTGGSRGIGRAIAVACAAEGADVAINYWGDNDVSYGRRSA-VAEVVAEIEALG 61 L+ K +++TG S GIGRA A+ C+ G V I GR A + E ++E G Sbjct: 7 LEGKNILITGASSGIGRATAIECSRMGGKVVIT---------GRNEARLLETFNQLEGEG 57 Query: 62 RRVIAIEGNVAARETGQQLVRHTVEAFGKVDVLASNAGICPFHAFLDMPPEVLESTVAVN 121 ++ A T +Q + H VE + L +NAG+ + + L+ + +N Sbjct: 58 HI------SLVADLTDEQQMEHLVEQLPLLHGLVNNAGMTETVPTQFIKRDKLDRILEIN 111 Query: 122 LNGAFYVTQAAAQQMKLQGTGGAIVATSSISAL-VGGGMQTHYTPTKAGVHSLMQSCAVA 180 +TQ + K+ G GG+IV T SIS V G Y+ +K +H +++ A+ Sbjct: 112 TISPILLTQKILKSKKI-GKGGSIVFTCSISGPHVSVGGNVLYSTSKGAIHGFVKNAALD 170 Query: 181 LGPYGIRCNSVMPGTIATDLNAQDLADEAKKAYFEKRIPLGRLGRPEDVADCVTFLASDR 240 L GIR N V PG I T + + + R P+ R G+PE+VA + +L S+ Sbjct: 171 LSIKGIRVNEVCPGMIHTHILDAGVISGEQLEVEASRYPMKRFGKPEEVAYGIIYLLSEA 230 Query: 241 ARYVTGAALLVDGG 254 + +VTG +++DGG Sbjct: 231 SSFVTGTGIVIDGG 244 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 248 Length adjustment: 24 Effective length of query: 236 Effective length of database: 224 Effective search space: 52864 Effective search space used: 52864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory