Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate WP_010529728.1 ON01_RS04100 betaine-aldehyde dehydrogenase
Query= metacyc::MONOMER-15108 (486 letters) >NCBI__GCF_000224785.1:WP_010529728.1 Length = 489 Score = 371 bits (953), Expect = e-107 Identities = 204/472 (43%), Positives = 289/472 (61%), Gaps = 6/472 (1%) Query: 15 IDGKFVPSLDGKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKALN-GPWKKMTANER 73 IDG +V S D INP ++ + TV E ++ A+ AA+KA + G W A ER Sbjct: 8 IDGSWVTSNSDAVRDIINPFNQKIVATVTESDESDTKAAITAARKAFDQGDWATTPAAER 67 Query: 74 IAVLRKVGDLILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHFFSDYIRTITNEAT 133 ++ K+ DLI +EEL+ LESLDTGK S D+ A F +F++ E Sbjct: 68 GKIVHKIADLIERDREELAELESLDTGKTVEESLG-DMDDIAGVFRYFAEMADKDGGEII 126 Query: 134 QMD-DVALNYAIRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVMKPAELTPMTATV 192 + + + + PVGV G I PWN PLL +WKLAPALAAGNT+VMKP+E+TP+T+ Sbjct: 127 ESPIPNSTSKVVHEPVGVCGQITPWNYPLLQASWKLAPALAAGNTLVMKPSEITPLTSIK 186 Query: 193 LAEICRDAGVPDGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTGKIIMASAAKTLK 252 + E+ +AGVP GVVNLV G G +S GA L+ + +V+ ISFTG TGK IM +A+ +K Sbjct: 187 VFELMAEAGVPAGVVNLVLGPG-DSVGAELSANDNVDLISFTGGIHTGKKIMQAASSNVK 245 Query: 253 RLSYELGGKNPNVIFADSNLDEVIETTMKSSFINQGEVCLCGSRIYVERPAYEAFLEKFV 312 L+ ELGGKNPN++FAD++ + ++ M + F + G++C G+R+ +E ++AF+ V Sbjct: 246 NLALELGGKNPNIVFADADFETAVDQAMNAVFFHAGQICSAGTRLIIEESIHDAFVSAIV 305 Query: 313 AKTKELVVGDPFDAKTKVGALISDEHYERVTGYIKLAVEEGGTILTGGKRPEG--LEKGY 370 + K + +G FD T++G LIS++H +V Y++ +EG T+ GG RP+ L+ G Sbjct: 306 DRVKNIKLGSGFDESTQMGPLISEDHLNKVVNYVENGKQEGATVAVGGSRPDDPELQNGL 365 Query: 371 FLEPTIITGLTRDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGLSASVWTNDLRRA 430 F PTI+TG T D RVV++E FGPV+TV F TEEE + ND+ YGLS V+TND+ +A Sbjct: 366 FYLPTILTGCTSDMRVVQDEGFGPVITVEKFTTEEEAVRLANDSIYGLSGGVFTNDIAKA 425 Query: 431 HRVAGQIEAGIVWVNTWFLRDLRTPFGGMKQSGIGREGGLHSFEFYSELTNI 482 R ++ G VW+N L P+GG KQSGIGRE G E Y E +I Sbjct: 426 ERCVAKLRMGTVWINDVNLYFPHAPWGGYKQSGIGRELGKTGLEEYQETKHI 477 Lambda K H 0.318 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 32 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 486 Length of database: 489 Length adjustment: 34 Effective length of query: 452 Effective length of database: 455 Effective search space: 205660 Effective search space used: 205660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory