Align IIB aka PtsB, component of N-Acetylglucosamine (NAG) porter (PtsBC1C2)(also may facilitate xylose transport) (characterized)
to candidate WP_010531770.1 ON01_RS14380 PTS transporter subunit EIIC
Query= TCDB::Q8GBT8 (95 letters) >NCBI__GCF_000224785.1:WP_010531770.1 Length = 535 Score = 57.4 bits (137), Expect = 2e-13 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 2/76 (2%) Query: 22 KAEKIVAGLGGIENIEEVEGCITRLRTEVVDASKV-DEAALKA-AGAHGVVKMGSAIQVV 79 KA + GLGG++NI V C TRLR V+D ++V D+ K GAHG+VK +IQV+ Sbjct: 454 KAAVYLEGLGGLDNIVNVTNCATRLRVTVIDPNEVKDDTYFKEHGGAHGLVKNNESIQVI 513 Query: 80 IGTDADPIAAEIEDMM 95 +G + IE + Sbjct: 514 VGLSVPQVRDSIESFI 529 Lambda K H 0.314 0.130 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 115 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 95 Length of database: 535 Length adjustment: 22 Effective length of query: 73 Effective length of database: 513 Effective search space: 37449 Effective search space used: 37449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory