Align PTS system N-acetylglucosamine-specific EIIC component; PTS system GlcNAc-specific EIIC component; GlcNAc-specific transporter; N-acetylglucosamine permease IIC component; GlcNAc permease IIC component (characterized)
to candidate WP_010531770.1 ON01_RS14380 PTS transporter subunit EIIC
Query= SwissProt::Q9S2H4 (416 letters) >NCBI__GCF_000224785.1:WP_010531770.1 Length = 535 Score = 185 bits (470), Expect = 2e-51 Identities = 132/426 (30%), Positives = 212/426 (49%), Gaps = 42/426 (9%) Query: 22 LQKVGRSLQLPIAVLPAAGIMVRLG--------QDDIFGKDGLGWDKVAAVFNNAGGALT 73 +++ G ++ +P+ + P GI+V L D+ DGL W ++ + N G + Sbjct: 4 VRRFGSAMIVPVLLFPFFGIIVGLAVLFKNEAIMGDLADPDGL-WYQIWTLIENGGWTVF 62 Query: 74 GSLPILFCIGVAIGFAKKADGSTALAAVVGFLVYSKVLEAF-----PVTEAVVQDGADVA 128 + ++F IG+ I A KA G L+A++G+L+++ + + P +Q A+V Sbjct: 63 NHMELVFVIGLPISLASKAQGRAVLSALMGYLMFNYFINSILTLWGPAFGVDMQ--AEVG 120 Query: 129 ATYN----------DPGVLGGIIMGLLAAVLWQRYHRKKLVDWLGFFNGRRLVPIIMAFV 178 T D +LG II+ + L RY+ KKL ++LG F G V +I F+ Sbjct: 121 GTSGLTEIAGIKTLDTNILGAIIISGIVIWLHNRYYDKKLPEFLGIFQGGPFVVMISFFL 180 Query: 179 GIVVGVFFGLVWEPIGDGISNFGEWMTGLGSGGAALFGGVNRALIPVGMHQFVNTVAWFQ 238 I + + +W I +GI++ +++ G LF + R LIP G+H F+ T F+ Sbjct: 181 MIPLALLTSWIWPVIQNGIASLQDFLINSSYIGVWLFHFLERILIPTGLHHFIYTP--FE 238 Query: 239 LGDFTNSAGDVVHG--DITRFL-AGDPSAGIFQAGFF----PIMMFGLPAAALAMAHTAR 291 G G + +T + + +P IF G F I MFG A+A+ A+ Sbjct: 239 YGPAVVDGGMKPYWIKHLTEYAQSSEPLREIFPGGGFLLQGNIKMFGSIGIAVAIYSAAK 298 Query: 292 PERRKAVLGMMISLAATSFVTGVTEPIEFSFMFIAPVLYVLHAVLTAISMAITWGLGVHA 351 PE RK V ++I T+ G+TEP+EF+F+FI+P L+ LHAVL A+ + I G+ + Sbjct: 299 PENRKKVAALLIPATLTAVFAGITEPLEFTFLFISPALFALHAVLGAVMVTIMHAFGLVS 358 Query: 352 GFNFSAGFIDY-ALNW-HLATKPWLI----IPIGLVFAAIYYVTFRFAIVKFNLKTPGRE 405 G G I+ A NW L + W + I IG++F IYY F++ IVKF++ PGRE Sbjct: 359 G-TMGGGLIEIAATNWIPLFSNNWNVYLAEIIIGIIFIFIYYYLFKYLIVKFDIPMPGRE 417 Query: 406 PEEEVE 411 E Sbjct: 418 KSGNTE 423 Lambda K H 0.326 0.142 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 583 Number of extensions: 36 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 535 Length adjustment: 33 Effective length of query: 383 Effective length of database: 502 Effective search space: 192266 Effective search space used: 192266 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory