Align Glutamate--putrescine ligase (EC 6.3.1.11) (characterized)
to candidate WP_010530711.1 ON01_RS09045 type I glutamate--ammonia ligase
Query= reanno::Koxy:BWI76_RS10710 (472 letters) >NCBI__GCF_000224785.1:WP_010530711.1 Length = 445 Score = 148 bits (374), Expect = 3e-40 Identities = 138/448 (30%), Positives = 205/448 (45%), Gaps = 51/448 (11%) Query: 36 NTQYVDVLLTDLNGCFRGKRIPVSGLSK-LEKGCYFPASVFAMDILGNV-VEEAGLGQEM 93 N +++ + TD+ G + IP+S L K L+ F S I G V +EE+ + + Sbjct: 18 NVRFIRLQFTDMLGNIKNVEIPLSQLDKALDNKMMFDGS----SIEGFVRIEESDMYLQ- 72 Query: 94 GEPDRTCVPVLGTLTPSAADPEYIGQVLLTMVDEDGAPFDVEPRNVLNRLWQQLRQRGLF 153 PD V P ++ + + + + + DG PF PR L R Q++ + G Sbjct: 73 --PDLDSFVVF----PWTSEKGKVARFICDIYNPDGTPFAGCPRYNLKRKLQKMEELGFN 126 Query: 154 PV-VAVELEFYLLDRKRDAEGYLQPPCAPGTGDRNTQSQVYSVD-NLNHFADVLNEIDEI 211 + E EF+L K D +G QP D + D N D++ E++E+ Sbjct: 127 AFNIGTEPEFFLF--KLDEKG--QPSME--LNDHGGYFDLAPTDLGENCRRDIVLELEEM 180 Query: 212 AQLQLIPADGAVAEASPGQFEINLHHTDNVLDACDDALALKRLVRLMAEKHKMHATFMAK 271 + + E +PGQ EI+ ++D V A DD K +VR +A KH +HATFM K Sbjct: 181 G----FEIEASHHEGAPGQHEIDFKYSDAVKHA-DDIQTFKLVVRTIARKHNLHATFMPK 235 Query: 272 PYEEHAGSGMHIHISMQNNKGENVLADADGED--SAMLKRALAGMIDLMPASMALLAPNV 329 P GSGMH+++S+ N GEN D DGE S + + AG+I A+ P V Sbjct: 236 PLFGVNGSGMHVNMSLFRN-GENAFFDKDGEMQLSDVAYQFTAGVIKHATNFTAVTNPTV 294 Query: 330 NSYRRFQPGMYVPTQASWGHNNRTVALRIPCGDRHNHRVEYRVAGADANPYLVMAAIFAG 389 NSY+R PG P +W NR+ +RIP + R+E R ANPY+ M+ + A Sbjct: 295 NSYKRLVPGYEAPCYVAWSGTNRSPLVRIPYSRGLSTRIEVRSVDPAANPYMAMSVLLAS 354 Query: 390 ILHGLDNPLPLQEEVEGN-------GLEQEGL-PFPIRQSDALWEFMQNDHLRERLGERF 441 L G++N L E V+ N E+ G+ P DAL Q++ + E LGE Sbjct: 355 GLDGVENKLTPPESVDQNIYDMDKKEREENGVKDLPATLMDALEVMQQDETIVEALGE-- 412 Query: 442 CHVYHACKNDELLQFERLITETEIEWML 469 H+Y E + IEW L Sbjct: 413 -HLY-----------EHFVEAKTIEWDL 428 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 472 Length of database: 445 Length adjustment: 33 Effective length of query: 439 Effective length of database: 412 Effective search space: 180868 Effective search space used: 180868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory