Align Proline dehydrogenase 2; PRODH 2; Proline oxidase 2; EC 1.5.5.2 (characterized)
to candidate WP_010531995.1 ON01_RS15500 proline dehydrogenase
Query= SwissProt::P94390 (303 letters) >NCBI__GCF_000224785.1:WP_010531995.1 Length = 341 Score = 289 bits (740), Expect = 5e-83 Identities = 138/297 (46%), Positives = 201/297 (67%), Gaps = 2/297 (0%) Query: 2 ITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTIRQLNSQGLSVTVDHLG 61 + RDFF+ LS + FLN A+ WG + A K + G S + +++LN QG+S T+D+LG Sbjct: 4 VMRDFFIGLSNNRFLNTQAKKWGFSLGADKFVAGTTVESVMEAVKELNHQGISCTLDNLG 63 Query: 62 EFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDIDMDLVYENMTKILQTAE 121 EFV+ A E ++ I+ + TI ++ ++ H+S+K+T LGLDID ENM +IL A Sbjct: 64 EFVSDKTEAGEAKDKIIRLLNTIHEENVDCHLSVKLTQLGLDIDQAYCTENMREILDIAR 123 Query: 122 KHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLYRTEKDIDDLDSLNPFLRL 181 ++ I V IDMED +TL++ + RK Y++V TV+Q+YLYR E+D+++L ++ LR+ Sbjct: 124 QYNIFVNIDMEDYSHYDQTLEVLQALRKDYDNVGTVIQSYLYRAEEDMENLKNVR--LRI 181 Query: 182 VKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIATHDDKMIDFTKQLAKEHGIA 241 VKGAYKESE+VA+PEK D+D N+ ++ +++L +T+I THD +I+ K A EH I Sbjct: 182 VKGAYKESEEVAYPEKQDIDRNFLELAKQRLAGDTFTSIGTHDHHIINELKAFADEHNID 241 Query: 242 NDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGYFMRRLAERPSNIAFAFK 298 +DKFEFQMLYG R+ Q L EGYN Y+P+G+DW+GYFMRRLAERP N+ K Sbjct: 242 HDKFEFQMLYGFRNDMQNKLANEGYNFCTYIPFGDDWFGYFMRRLAERPQNMTLVLK 298 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 306 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 341 Length adjustment: 28 Effective length of query: 275 Effective length of database: 313 Effective search space: 86075 Effective search space used: 86075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory