Align ADP-specific glucokinase (EC 2.7.1.147) (characterized)
to candidate WP_010530988.1 ON01_RS10435 ROK family glucokinase
Query= BRENDA::Q8R8N4 (312 letters) >NCBI__GCF_000224785.1:WP_010530988.1 Length = 323 Score = 224 bits (571), Expect = 2e-63 Identities = 118/309 (38%), Positives = 175/309 (56%), Gaps = 1/309 (0%) Query: 3 IGVDLGGTNIAVGLVEEDGKIIATGSRPTKPERGYEAIARDIAELSFELLQRMGISVKDV 62 +GVD+GGT + +G+++ DG I+ + T E I DI + E L + I K + Sbjct: 6 VGVDIGGTTVKIGIIDNDGNILDKWAIHTNRTNSGEFIVSDIWKSLDERLAKNAIPKKTI 65 Query: 63 KSMGIGVPGVADNEKGIVIRAVNLFWTKVPLAKEIRKYIDLPIYMENDANVAALAEATFG 122 + +GIG PG DN+ G V AVN+ W +PL+ E+R LP+++ NDAN A + E G Sbjct: 66 EGIGIGAPGFIDNDTGYVFEAVNIGWRNMPLSDELRSISGLPVFVANDANAAVMGENWKG 125 Query: 123 AGRGSKSSVTITLGTGVGSGFILDGKIYSGAHHFAPEIGHMVIGDNGIRCNCGKIGCFET 182 AG K+ V +TLGTGVG G I++G I +G A EIGH + +GI CNCG+ GC ET Sbjct: 126 AGGNVKNLVALTLGTGVGGGIIVNGDILNGESGMAGEIGHTTVEPDGILCNCGRRGCLET 185 Query: 183 YASATALIREGKKAAKRNPNTLILKFANGDIEGITAKNVIDAAKQYDEEALKIFEEYVKY 242 ASAT ++R+ K K++P + + ITAK++ + A D +I Sbjct: 186 IASATGMVRQAKMKTKQHPESRLASRLESS-GNITAKDIFELADAGDVPCREIIAYTADV 244 Query: 243 LAVGIVNIINLFDPEVIILGGGVANAGDFLLKPLKKEVAENILFKELPYADIRKAELGND 302 L + I N L +P +++GGGV++AGD +K ++ L + +++ A+LGND Sbjct: 245 LGLAISNASTLINPSKVLIGGGVSSAGDVFIKLIENAFRRYALTRVSDICELKLAQLGND 304 Query: 303 AGIIGAAIL 311 AGIIGAA L Sbjct: 305 AGIIGAAFL 313 Lambda K H 0.318 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 323 Length adjustment: 27 Effective length of query: 285 Effective length of database: 296 Effective search space: 84360 Effective search space used: 84360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory