Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_010529728.1 ON01_RS04100 betaine-aldehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >NCBI__GCF_000224785.1:WP_010529728.1 Length = 489 Score = 336 bits (862), Expect = 9e-97 Identities = 186/474 (39%), Positives = 271/474 (57%), Gaps = 8/474 (1%) Query: 4 KLLINGELVSGEGEK-QPVYNPATGDVLLEIAEASAEQVDAAVRAADAAF--AEWGQTTP 60 K LI+G V+ + + + NP ++ + E+ AA+ AA AF +W T Sbjct: 5 KQLIDGSWVTSNSDAVRDIINPFNQKIVATVTESDESDTKAAITAARKAFDQGDWATTPA 64 Query: 61 KVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNG 120 R + + K+AD+IE + + AELES + GK + + D + I VFR+FA A G Sbjct: 65 AERGKIVHKIADLIERDREELAELESLDTGKTVEESLGD-MDDIAGVFRYFAEMADKDGG 123 Query: 121 LAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLT 180 + TS + +P+GV I PWNYPL+ A+WKLAPALAAGN +V+KPSEITPLT Sbjct: 124 EIIESPIPNSTSKVVHEPVGVCGQITPWNYPLLQASWKLAPALAAGNTLVMKPSEITPLT 183 Query: 181 ALKLAELAKDI-FPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASS 239 ++K+ EL + PAGV+N++ G G +VG L+ + V ++S TG I TG+ I+ +S+ Sbjct: 184 SIKVFELMAEAGVPAGVVNLVLGPGDSVGAELSANDNVDLISFTGGIHTGKKIMQAASSN 243 Query: 240 IKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEK 299 +K +ELGGK P IVF DAD E V+ +++AGQ C+A R+ ++ I+D V Sbjct: 244 VKNLALELGGKNPNIVFADADFETAVDQAMNAVFFHAGQICSAGTRLIIEESIHDAFVSA 303 Query: 300 LGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGG---EKRKGN 356 + V +K G+ DEST++GPL S HL +V VE K G + G + N Sbjct: 304 IVDRVKNIKLGSGFDESTQMGPLISEDHLNKVVNYVENGKQEGATVAVGGSRPDDPELQN 363 Query: 357 GYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVG 416 G +Y PT+L G D +VQ E FGPV++V F EE+ V ANDS YGL+ V+T D+ Sbjct: 364 GLFYLPTILTGCTSDMRVVQDEGFGPVITVEKFTTEEEAVRLANDSIYGLSGGVFTNDIA 423 Query: 417 RAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHV 470 +A R A+L+ G W+N + P GG K SG G+++ GLE+Y +H+ Sbjct: 424 KAERCVAKLRMGTVWINDVNLYFPHAPWGGYKQSGIGRELGKTGLEEYQETKHI 477 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 489 Length adjustment: 34 Effective length of query: 440 Effective length of database: 455 Effective search space: 200200 Effective search space used: 200200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory