Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_010530529.1 ON01_RS08095 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= BRENDA::A4VVI7 (210 letters) >NCBI__GCF_000224785.1:WP_010530529.1 Length = 210 Score = 162 bits (410), Expect = 4e-45 Identities = 83/206 (40%), Positives = 127/206 (61%), Gaps = 2/206 (0%) Query: 5 MLKQLKENYFFAVIRGKDEEDAKEIARHAILGGIRNIEITFSTPNAATVIKELQEEFSDD 64 +L Q+ + VIRG + A++IA GGI+ +E+TF+ P A +I+ L +D Sbjct: 6 ILNQMIASKLAVVIRGDNLTMAEKIAVACEKGGIKTLEVTFTVPKAGHLIETLIARCDED 65 Query: 65 SSVVIGAGTVMNLKLAQAAIDAGASFLVSPHFDKEIQDLAQEAEVFYFPGCATATEIVTA 124 V++GAGTV++ + A+ AI +GA F+VSP FDKE L ++ Y PGC T E++ A Sbjct: 66 --VLVGAGTVLDSETARIAIISGAKFIVSPSFDKETAKLCNRYQIPYLPGCMTINEMLRA 123 Query: 125 SQAGCPIIKLFPGGVLGPGFIKDIHGPVPDVNLMPSGGVSVENVADWKKAGACAVGVGSA 184 ++ G ++KLFPG P FIK+IHGP+P +N+MP+GG++V+NV W +AGA VGVG Sbjct: 124 TEYGVSVLKLFPGQSYEPSFIKNIHGPLPYLNIMPTGGITVDNVGSWLEAGAVMVGVGGE 183 Query: 185 LASRVQAEGYESVTTIARSFVAALEG 210 + + Y+ V +A F ++G Sbjct: 184 ITRPAKDGDYDKVEQLANEFQKKVQG 209 Lambda K H 0.317 0.134 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 210 Length adjustment: 21 Effective length of query: 189 Effective length of database: 189 Effective search space: 35721 Effective search space used: 35721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory