Align SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized)
to candidate WP_010530733.1 ON01_RS09150 ABC transporter ATP-binding protein
Query= TCDB::P54933 (332 letters) >NCBI__GCF_000224785.1:WP_010530733.1 Length = 355 Score = 164 bits (415), Expect = 3e-45 Identities = 90/240 (37%), Positives = 139/240 (57%), Gaps = 5/240 (2%) Query: 4 ITLRNVQKRFGEAV-VIPSLDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDVSDGQIMI 62 I +V+K + + I L I +GE V +GPSGCGK+T +++I L + + G I I Sbjct: 2 IQFSDVKKTYPDGTKAINDFSLKINEGELVTLIGPSGCGKTTTMKMINRLIEPTAGTIYI 61 Query: 63 DGRDATE--MPPAKRGLAMVFQSYALYPHMTVKKNIAFPLRMAKMEPQEIERRVSNAAKI 120 +G + + + + + V Q AL+PHMT+++NIA M K + +EI R ++ Sbjct: 62 NGTNINDYNIHELRWNIGYVLQQIALFPHMTIEENIAVVPEMKKWKRKEIRERSEELLEM 121 Query: 121 --LNLTNYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVNMRLEITE 178 LN + Y+ RRP +LSGG++QRV + RA+ +P L DEP S LD R ++ +I + Sbjct: 122 VGLNSSTYMHRRPSELSGGEQQRVGVIRALAADPDIILMDEPFSALDPISREQLQHDIKK 181 Query: 179 LHQSLETTMIYVTHDQVEAMTMADKIVVLNAGRIEQVGSPLTLYRNPANLFVAGFIGSPK 238 LHQ + T+++VTHD EA+ + DK+ ++ GRI QV +P L +P FV FIG K Sbjct: 182 LHQEIRKTIVFVTHDIDEALALGDKVCLMKEGRIIQVDTPQQLVLHPETTFVKDFIGERK 241 Lambda K H 0.320 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 355 Length adjustment: 29 Effective length of query: 303 Effective length of database: 326 Effective search space: 98778 Effective search space used: 98778 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory