Align 5-dehydro-2-deoxygluconokinase; 2-deoxy-5-keto-D-gluconate kinase; DKG kinase; EC 2.7.1.92 (characterized)
to candidate WP_010529989.1 ON01_RS05395 sugar kinase
Query= SwissProt::P42414 (325 letters) >NCBI__GCF_000224785.1:WP_010529989.1 Length = 317 Score = 159 bits (402), Expect = 9e-44 Identities = 103/307 (33%), Positives = 168/307 (54%), Gaps = 6/307 (1%) Query: 12 DIVAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGSAKLGLKAGFIGKIPDDQH 71 D+V +G + L E+ PM + FS V G+ +N+AIG A+LG+++G++ ++ +D+ Sbjct: 2 DVVTLGETMV-LFTPEHAGPMRYSDRFSSRVAGAESNVAIGLARLGVQSGWMSRLGNDEF 60 Query: 72 GRFIESYMRKTGVDTTQMIVDQDGHKAGLAFTEILSPEECSILMYRDDVADLYLEPSEVS 131 G+ I S++R GVDT+++I D+ GL F E L+ E + YR D A L+P ++ Sbjct: 61 GKKIRSFIRGEGVDTSRVIFDETA-DTGLFFKEKLANGEWRVKYYRRDSAASRLKPEDLD 119 Query: 132 EDYIANAKMLLVSGTALAKSPS-REAVLKAVQYAKKHQVKVVFELDYRPYTWQSSDETAV 190 E YIA AK L V+G A S S E VL A++YAK+H VKVVF+ + R W V Sbjct: 120 ESYIAGAKYLHVTGITPALSDSCYETVLSAIEYAKRHDVKVVFDPNLRRKLWPEHKARKV 179 Query: 191 YYSLVAEQSDIVIGTRDEFDVMENRTGGSNEESVNHLFGHSADLVVIKHGVEGSYAYSKS 250 LV ++DIV+ +E + + GS EE A V++K G EG+Y + Sbjct: 180 LVELV-RKADIVLPGIEEAEFLFGI--GSPEELARQFNEQGASTVIMKLGEEGAYYLTHD 236 Query: 251 GEVFRAQAYKTKVLKTFGAGDSYASAFIYGLVSGKDIETALKYGSASASIVVSKHSSSEA 310 E + T+V+ GAGD +++ + GL+ G ++E +++ G+A ++ V E Sbjct: 237 TERYVEGFRVTEVVDPVGAGDGFSAGVLSGLLDGLNLEDSVQRGNAIGAMAVLAAGDIEG 296 Query: 311 MPTAEEI 317 +P + + Sbjct: 297 LPEKDRL 303 Lambda K H 0.314 0.130 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 317 Length adjustment: 28 Effective length of query: 297 Effective length of database: 289 Effective search space: 85833 Effective search space used: 85833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory