Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_010529728.1 ON01_RS04100 betaine-aldehyde dehydrogenase
Query= BRENDA::P05091 (517 letters) >NCBI__GCF_000224785.1:WP_010529728.1 Length = 489 Score = 395 bits (1014), Expect = e-114 Identities = 214/474 (45%), Positives = 293/474 (61%), Gaps = 10/474 (2%) Query: 41 INNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASH 100 I+ W + S +NP +++ V E D+ D A+ AAR AF G W A+ Sbjct: 8 IDGSWVTSNSDAVRDIINPFNQKIVATVTESDESDTKAAITAARKAFDQGD-WATTPAAE 66 Query: 101 RGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKT 160 RG++++++ADLIERDR LA LE+LD GK V L D+D + RY+A ADK G+ Sbjct: 67 RGKIVHKIADLIERDREELAELESLDTGKT-VEESLGDMDDIAGVFRYFAEMADKDGGEI 125 Query: 161 I--PIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTA 218 I PI S HEPVGVCGQI PWN+PLL +WKL PALA GN +VMK +E TPLT+ Sbjct: 126 IESPIPNST-SKVVHEPVGVCGQITPWNYPLLQASWKLAPALAAGNTLVMKPSEITPLTS 184 Query: 219 LYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSN 278 + V L+ EAG P GVVN+V G G + GA ++++++VD ++FTG G+ I AA SSN Sbjct: 185 IKVFELMAEAGVPAGVVNLVLGPGDSVGAELSANDNVDLISFTGGIHTGKKIMQAA-SSN 243 Query: 279 LKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVER 338 +K + LELGGK+PNI+ +DAD + AV+QA A+FF+ GQ C AG+R ++E I+D FV Sbjct: 244 VKNLALELGGKNPNIVFADADFETAVDQAMNAVFFHAGQICSAGTRLIIEESIHDAFVSA 303 Query: 339 SVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAAD----R 394 V R K+ +G+ FD T+ GP + E K++ Y+ GKQEGA + GG D Sbjct: 304 IVDRVKNIKLGSGFDESTQMGPLISEDHLNKVVNYVENGKQEGATVAVGGSRPDDPELQN 363 Query: 395 GYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLD 454 G F PT+ M + ++E FGPV+ + KF T EE V AN+S YGL+ VFT D+ Sbjct: 364 GLFYLPTILTGCTSDMRVVQDEGFGPVITVEKFTTEEEAVRLANDSIYGLSGGVFTNDIA 423 Query: 455 KANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTV 508 KA L+ GTVW+N +++ +P+GGYK SG GRELG+ GL+ Y E K + Sbjct: 424 KAERCVAKLRMGTVWINDVNLYFPHAPWGGYKQSGIGRELGKTGLEEYQETKHI 477 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 489 Length adjustment: 34 Effective length of query: 483 Effective length of database: 455 Effective search space: 219765 Effective search space used: 219765 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory