Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate WP_010532097.1 ON01_RS16395 aldehyde dehydrogenase family protein
Query= BRENDA::P05091 (517 letters) >NCBI__GCF_000224785.1:WP_010532097.1 Length = 506 Score = 367 bits (942), Expect = e-106 Identities = 209/484 (43%), Positives = 285/484 (58%), Gaps = 22/484 (4%) Query: 40 FINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDAS 99 +I E+ + K F V+P TG+V C++A KEDV+ AV A AA W + + Sbjct: 22 YIGGEYRPPANGKYFENVSPVTGKVFCELARSTKEDVEAAVDAGYAA---KDAWAQTSVA 78 Query: 100 HRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGK 159 R +LN++AD +E + LA ET DNGK D+ + + RY+AG G Sbjct: 79 ERADILNKIADRMEENLESLAVAETWDNGKAVREGLAADIPLAVDHFRYFAGAIRAQEGG 138 Query: 160 TIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTAL 219 ID D +Y HEP+GV GQIIPWNFP+LM WKL PALA GN VV+K AEQTP + Sbjct: 139 VSQIDNDTVAYHFHEPLGVVGQIIPWNFPILMATWKLAPALAAGNCVVLKPAEQTPASIH 198 Query: 220 YVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNL 279 + +LIK+ P GV+NIV GFG AG +AS+ + K+AFTG T GR+I A S N+ Sbjct: 199 VLLDLIKDL-LPAGVLNIVNGFGVEAGKPLASNSRISKIAFTGETTTGRLIMQYA-SENI 256 Query: 280 KRVTLELGGKSPNIIM------SDADMDWAVE-QAHFALFFNQGQCCCAGSRTFVQEDIY 332 VTLELGGKSPNI D +D A+E FAL NQG+ C SR V E IY Sbjct: 257 IPVTLELGGKSPNIFFPDVMDKDDGFLDKAIEGLVMFAL--NQGEVCTCPSRALVHESIY 314 Query: 333 DEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGI-- 390 DEF+ER++ R +G+P D+ T G Q Q +KI Y++ G+QEGA++L GGG+ Sbjct: 315 DEFMERAIKRVNEIKIGHPLDTDTMMGAQASLEQMEKIKSYLDIGRQEGAEVLVGGGVNQ 374 Query: 391 ---AADRGYFIQPTVF-GDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAA 446 + GY+I+PT+F GD + M I +EEIFGPV+ + F +E + AN++ YGL A Sbjct: 375 LKGDMEEGYYIEPTIFKGD--NKMRIFQEEIFGPVLAVTTFNENDEAMKIANDTLYGLGA 432 Query: 447 AVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVK 506 V+T++++ A + ++AG VW+NCY + A + FGGYK SG GRE L Y + K Sbjct: 433 GVWTRNINTAYRFGRGIEAGRVWMNCYHQYPAHAAFGGYKKSGIGRENHLMMLDHYQQTK 492 Query: 507 TVTV 510 + + Sbjct: 493 NLLI 496 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 633 Number of extensions: 33 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 506 Length adjustment: 35 Effective length of query: 482 Effective length of database: 471 Effective search space: 227022 Effective search space used: 227022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory