Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_010529728.1 ON01_RS04100 betaine-aldehyde dehydrogenase
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_000224785.1:WP_010529728.1 Length = 489 Score = 376 bits (966), Expect = e-109 Identities = 196/471 (41%), Positives = 291/471 (61%), Gaps = 7/471 (1%) Query: 25 INNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAF-HSSWSTSDPQVR 83 I+ +V S S ++P ++ + V E+ D A+ AA AF W+T+ R Sbjct: 8 IDGSWVTSNSDAVRDIINPFNQKIVATVTESDESDTKAAITAARKAFDQGDWATTPAAER 67 Query: 84 MKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKGDVALTAAYFRSCAGWTDKIKGSVIE 143 K+++K+ADLI+ + LA +E+LD GK++ S GD+ A FR A DK G +IE Sbjct: 68 GKIVHKIADLIERDREELAELESLDTGKTVEESLGDMDDIAGVFRYFAEMADKDGGEIIE 127 Query: 144 TG-DTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSALYL 202 + + EP+GVCGQI PWN+PLL ASWKL P L G T V+K +E TPL+++ + Sbjct: 128 SPIPNSTSKVVHEPVGVCGQITPWNYPLLQASWKLAPALAAGNTLVMKPSEITPLTSIKV 187 Query: 203 ASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNLKK 262 L+ EAG P GVVN+V G G + GA +S++ + ++FTG TG+ IM+AA+ SN+K Sbjct: 188 FELMAEAGVPAGVVNLVLGPGDSVGAELSANDNVDLISFTGGIHTGKKIMQAAS-SNVKN 246 Query: 263 VTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEFKN 322 + LELGGK+PNIVF DAD ++ + + +F++ G++C AG+R+ ++E I+D VS + Sbjct: 247 LALELGGKNPNIVFADADFETAVDQAMNAVFFHAGQICSAGTRLIIEESIHDAFVSAIVD 306 Query: 323 AAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGN----KGYF 378 +++K+G F E T MG S+ L+K++ Y++ GK+EGATV GG R + G F Sbjct: 307 RVKNIKLGSGFDESTQMGPLISEDHLNKVVNYVENGKQEGATVAVGGSRPDDPELQNGLF 366 Query: 379 IKPTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTAI 438 PTI D ++V+DE FGPV+T+ KF T EE + LANDS YGL+ GV T +++ A Sbjct: 367 YLPTILTGCTSDMRVVQDEGFGPVITVEKFTTEEEAVRLANDSIYGLSGGVFTNDIAKAE 426 Query: 439 SVSNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAV 489 K+ GT+W+N N + P P+GGY QSGIGRE+G+ L+ Y + K + Sbjct: 427 RCVAKLRMGTVWINDVNLYFPHAPWGGYKQSGIGRELGKTGLEEYQETKHI 477 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 596 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 489 Length adjustment: 34 Effective length of query: 461 Effective length of database: 455 Effective search space: 209755 Effective search space used: 209755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory