Align Sorbitol (D-Glucitol):H+ co-transporter, SOT1 (Km for sorbitol of 0.64 mM) of 509 aas and 12 TMSs (Gao et al. 2003). SOT1 of P. cerasus is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves (characterized)
to candidate WP_010531702.1 ON01_RS14040 sugar porter family MFS transporter
Query= TCDB::AIU41385.1 (509 letters) >NCBI__GCF_000224785.1:WP_010531702.1 Length = 455 Score = 258 bits (659), Expect = 3e-73 Identities = 157/456 (34%), Positives = 250/456 (54%), Gaps = 33/456 (7%) Query: 33 LASMTSILLGYDIGVMSGASIYIQEDLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIG 92 L ++ +L GYD+GV+SGA +YI+ D+ ++ +++ + + ++ GS ++G SD G Sbjct: 14 LGALGGLLYGYDMGVISGALLYIKNDIPLTSFTEGLVVSSMLVGAIFGSGSSGPLSDKFG 73 Query: 93 RRYTIVFAGAIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALMIAPVYNAEVSPASSRG 152 RR + ++ GAL + FA N L+VGR + G+ VG + I PVY +E++P SRG Sbjct: 74 RRRLVFMISILYIVGALTLAFAPNMVTLVVGRLIIGVAVGGSTAIVPVYLSEMAPTESRG 133 Query: 153 ALTSFPEVFVNIGILLGYVANYAFSGLPINLGWRLMLGVGVFPSVILAVGVLTMPESPRW 212 +L+S ++ + IGIL Y+ NYAF+ PI GWR MLG+ V PS+IL VGVL MPESPRW Sbjct: 134 SLSSLNQLMITIGILSSYLVNYAFA--PIE-GWRWMLGLAVVPSLILMVGVLFMPESPRW 190 Query: 213 LVMQGRLGDAKHVLDKTSDSLEEAQLRLADIKEAAGIPEHCTEDVVQVPKHSHGE-EVWK 271 L+ A+ V+ T E Q +I E ++++ + S V K Sbjct: 191 LLEHRGKEAARRVMKLTRKENEIDQ----EINE-----------MIEINRVSDSTWNVLK 235 Query: 272 ELLLHPTPPVRHILIAAVGFHFFQQMSGIDALVLYSPRIFRASGITDSSTLLLATVAVGF 331 L PT L+ F QQ+ GI+A++ Y+P IF +G+ D T +L TV +G Sbjct: 236 SAWLRPT------LVIGCTFALLQQIIGINAIIYYAPTIFNEAGLGD-VTSILGTVGIGT 288 Query: 332 SKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKEKMMWASVVCLTM 391 +FT++AI +D++ R+ LL+T GM+ SL+ + + + W V CLT+ Sbjct: 289 VNVLFTIVAIMIIDKIDRKKLLITGNIGMVGSLVIMAGLIWTIGLGSTVGAWIIVACLTL 348 Query: 392 VLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLTMT--FITLYKAI 449 ++ FF+ GP+ WV E+FP +RA+G + G A + G L + F L + + Sbjct: 349 ---FIIFFAFTWGPVLWVMLPELFP--MRARGAATGIAALALSIGSLLVAQFFPMLTEVM 403 Query: 450 TMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDME 485 ++ F ++ I +F LPET+ R+LE++E Sbjct: 404 SIEQVFLIFAVIGIGAMIFVVKYLPETRARSLEEIE 439 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 651 Number of extensions: 43 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 455 Length adjustment: 34 Effective length of query: 475 Effective length of database: 421 Effective search space: 199975 Effective search space used: 199975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory