Align Galactitol 2-dehydrogenase; GDH; Sorbitol dehydrogenase; SorbD; EC 1.1.1.16; EC 1.1.1.- (characterized)
to candidate WP_010531835.1 ON01_RS14700 D-threitol dehydrogenase
Query= SwissProt::A9CES4 (256 letters) >NCBI__GCF_000224785.1:WP_010531835.1 Length = 255 Score = 145 bits (366), Expect = 8e-40 Identities = 92/256 (35%), Positives = 136/256 (53%), Gaps = 20/256 (7%) Query: 3 LNNKVALITGAARGIGLGFAQAFAAEGAKVIIADI-----DIARATTSAAAIGPAAKAVK 57 + K A+ITG A GIG A + +GA V I D+ ++A+ AIG VK Sbjct: 12 ITGKTAIITGGANGIGRAIASLYLEKGANVAIFDLKNNVEEVAQELNPKNAIG-----VK 66 Query: 58 LDVTDLAQIDAVVKAVDEEFGGIDILVNNAAIFDMAPINGITEESYERVFDINLKGPMFM 117 D+TD I+ +K V + +G IDILVN A + + ++ E +++ D+NL M Sbjct: 67 CDITDGENINESLKKVKDRYGKIDILVNCAGVALLDDAENLSHEFWQKTIDLNLTASFKM 126 Query: 118 MKAVSNVMIARARGGKIINMASQAGRRGEALVTLYCASKAAIISATQSAALALVKHGINV 177 + V N+MI + GGKIINMASQA Y ASK+ I+ T++ A + INV Sbjct: 127 CQKVGNIMIEQGEGGKIINMASQAALIALENHIAYSASKSGILGITKNLAFEWAQFNINV 186 Query: 178 NAIAPGVVDGEHWEVVDAHFAKWEGLKPGEKKAAVAKSVPIGRFATPDDIKGLAVFLASA 237 NAI+P V+ + + W G K GEK K +P+GRF P+++ +A+FLAS Sbjct: 187 NAISPTVI------LTELGKKAWAGEK-GEK---AKKEIPLGRFGYPEEVAAIALFLASD 236 Query: 238 DSDYILAQTYNVDGGN 253 ++ I + +DGGN Sbjct: 237 ATNLITGENIVIDGGN 252 Lambda K H 0.319 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 4 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 255 Length adjustment: 24 Effective length of query: 232 Effective length of database: 231 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory