Align PTS system glucitol/sorbitol-specific EIIC component; EIIC-Gut; Glucitol/sorbitol permease IIC component (characterized)
to candidate WP_010531686.1 ON01_RS13960 PTS sorbitol transporter subunit IIC
Query= SwissProt::O32521 (182 letters) >NCBI__GCF_000224785.1:WP_010531686.1 Length = 178 Score = 133 bits (335), Expect = 2e-36 Identities = 68/163 (41%), Positives = 95/163 (58%) Query: 10 EWFIGLFQKGGEVFVGMVTGILPLLISLLVIMNALIVFVGQRRIEKLAQKCAGNPVTRYL 69 E FIGLF GGE F+ + I+P L+ LL A+I F+G+ R+ K Q + V RY Sbjct: 9 EHFIGLFNAGGEQFMNLFNSIVPTLVVLLTFTYAMIKFIGEDRVTKGIQFASRFTVLRYT 68 Query: 70 VLPFIGTFVFCNPMTHSLGKFLPEKYKPSYYAAASYSCHSMNGLFPHINPGELFVYLGIA 129 ++P + + NPM ++ G+F+ E+ KP+++ + H + LFP+ N GELFVYLGIA Sbjct: 69 LMPILSILLLTNPMAYTFGRFVKEEQKPAFFDSLVSFLHPVTSLFPYANAGELFVYLGIA 128 Query: 130 NGLTTLGVPLGPLAVSYLLVGLITNFFRGWVTDLTTSVFEKKM 172 NGL G LAV Y LVG+I RG VT+ + KKM Sbjct: 129 NGLAQAGYSQSELAVRYFLVGIIVILIRGIVTEQISKYLAKKM 171 Lambda K H 0.327 0.145 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 182 Length of database: 178 Length adjustment: 19 Effective length of query: 163 Effective length of database: 159 Effective search space: 25917 Effective search space used: 25917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory