Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_010531959.1 ON01_RS15330 hydroxyacid dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >NCBI__GCF_000224785.1:WP_010531959.1 Length = 317 Score = 137 bits (346), Expect = 3e-37 Identities = 72/190 (37%), Positives = 114/190 (60%), Gaps = 8/190 (4%) Query: 77 GYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGDFDLDGL 136 G D+ID+E AK I V+ + ++A++ +A ML R L A VR G++D Sbjct: 75 GLDNIDLEAAKERNIPVIAAKNANATSVAEYVMAAMLDASRPLSDADADVRRGNWDRKFF 134 Query: 137 MGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQP--------EIVENVDLDT 188 G++LN + G++G+G+I VA R KAFG V+GYDP++ P + LD Sbjct: 135 TGYELNKRTLGLVGMGEIANRVARRAKAFGMDVIGYDPFVAPFDHVLAETGVRPAETLDE 194 Query: 189 LITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLG 248 L++++D +S+H PLT+ HM N++ F MK A ++N+ARGG++ + L+EA++S ++ Sbjct: 195 LLSESDFVSVHVPLTKATKHMINKDNFPLMKSHAYVINSARGGIVHEQDLIEAVQSEQIA 254 Query: 249 GAALDVYEYE 258 GA LDV E E Sbjct: 255 GAYLDVLEKE 264 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 317 Length adjustment: 28 Effective length of query: 297 Effective length of database: 289 Effective search space: 85833 Effective search space used: 85833 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory