Align SDR family oxidoreductase (characterized, see rationale)
to candidate WP_010529707.1 ON01_RS04000 SDR family oxidoreductase
Query= uniprot:A0A4P7ABK7 (254 letters) >NCBI__GCF_000224785.1:WP_010529707.1 Length = 253 Score = 144 bits (364), Expect = 1e-39 Identities = 90/262 (34%), Positives = 147/262 (56%), Gaps = 28/262 (10%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDIS----KTHLEELASIAGV----ET 58 +L K ++T AA G+G+ +L+A+EGA+V+A D++ +T ++E+ GV + Sbjct: 2 KLQDKVAIVTGAASGMGKEIAKLYAKEGAKVVAADLNLEGVETVVKEITENNGVAKAVQV 61 Query: 59 HLLDVTD-DDAIKALVAKVGTVDVLFNCAG----YVAAGNILECDDKAWDFSFNLNAKAM 113 ++ + D D+ I + + GT+D+L N AG + G++L D+ WD F++N K + Sbjct: 62 NIAEQDDIDNMIDTAINEHGTLDILVNNAGIMDGFEPVGDVL---DERWDLIFDVNTKGV 118 Query: 114 FHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQG 173 ++R +P L K++G I+N AS G AYGASK AV+G+TK+ + +G Sbjct: 119 MRSMRKAIPIFLDKESGVIINTASTGG-FNGAHAGAAYGASKHAVIGMTKNTGYMYAQKG 177 Query: 174 IRCNAICPGTIES--PSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALAL 231 IRCNAI PG + + S + +S E K V M R G+ +E+A +AL Sbjct: 178 IRCNAIAPGGVATNIASSMESVSQYGMERTKPVHSV---------MPRAGEPDEIAKVAL 228 Query: 232 YLASDESNFTTGSIHMIDGGWS 253 +LASD+S+F G++ DGGW+ Sbjct: 229 FLASDDSSFVNGTVVTADGGWT 250 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory