Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_009140161.1 HMPREF9452_RS00665 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_000225705.1:WP_009140161.1 Length = 260 Score = 260 bits (665), Expect = 2e-74 Identities = 136/242 (56%), Positives = 171/242 (70%) Query: 19 DEIAIQISQMNKWYGQFHVLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGK 78 +E +QI ++K YG VLR I+L VHRGE +V+ GPSGSGKSTM+RC+N LE +G Sbjct: 18 EEPVVQIHGLHKAYGDNVVLRGIDLDVHRGEVVVVLGPSGSGKSTMLRCVNLLETPTNGS 77 Query: 79 IIVDGIELTSDLKNIDKVRSEVGMVFQHFNLFPHLTILENLTLAPIWVRKVPKREAEETA 138 I+V+G+++T I+KVRS +GMVFQ FNLFPHL+ N+ +A V K K EAE A Sbjct: 78 IVVEGVDITKKGVEINKVRSTLGMVFQQFNLFPHLSAKRNVMIAQQKVLKRSKEEAERIA 137 Query: 139 MYYLEKVKIPEQAQKYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLD 198 L KV + ++ P QLSGGQQQRVAIAR+L M P +MLFDE TSALDPE++++VL Sbjct: 138 EMELAKVGLADRVDFMPSQLSGGQQQRVAIARALAMNPHVMLFDEATSALDPELVRDVLG 197 Query: 199 TMIQLAEEGMTMLCVTHEMGFAQAVANRVIFMADGQIVEQNNPHDFFHNPQSERTKQFLS 258 M LA GMTM+ VTHEMGFA+ VA+RVIFM G IVEQ P + F +P+SERTK FL Sbjct: 198 VMRDLARGGMTMIVVTHEMGFARDVADRVIFMDGGVIVEQGTPEEVFDHPKSERTKDFLG 257 Query: 259 QI 260 I Sbjct: 258 HI 259 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 222 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 260 Length adjustment: 25 Effective length of query: 238 Effective length of database: 235 Effective search space: 55930 Effective search space used: 55930 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory