Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_040362776.1 HMPREF9452_RS07915 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_000225705.1:WP_040362776.1 Length = 337 Score = 163 bits (413), Expect = 5e-45 Identities = 97/295 (32%), Positives = 153/295 (51%), Gaps = 7/295 (2%) Query: 43 LLPGHTPTLPEALVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAA 102 L G +P ++ +RLPR++ + L+G SLAL+G LLQ NP+A P +LGI+SGA Sbjct: 44 LAAGPSPDAASQIIWEIRLPRAIASTLLGGSLALSGLLLQVFFDNPIADPFVLGISSGAK 103 Query: 103 LAMALTS--ALSPTPIAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALS 160 L +AL + + +S AA G + + ++ A R R LI+AG+ + Sbjct: 104 LCVALLMIVVMGAGSVMTTWMSVAAAVTGSLLAMALVLAVS--RRVRSRGTLIVAGVMIG 161 Query: 161 AFCMGLTRITLLLAEDHAY-GIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLN 219 C T + A+D + + W G S W D+ + P V +L+ L Sbjct: 162 YICSAATNFLIAFADDQSIVNLHNWSLGSFSGTSWTDIVAIAPTVAITAVATFVLSKPLG 221 Query: 220 LLNLSDSTAHTLGVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQ 279 L + AH++GVN+ R I ML ++ V+ AGP++F+G+ PHLA+ G + Sbjct: 222 AYQLGEDYAHSVGVNIRAFRSAIVMLSSIMSACTVAFAGPISFVGIAAPHLAKQALGTSK 281 Query: 280 R-NVLPVSMLLGATLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWL-VRRRG 332 V+P S L+GA L D++AR L P +L AV A++G+P +WL +++RG Sbjct: 282 PIAVVPASFLMGALLCSACDLIARMLFSPVELSVSAVTAVLGAPLVIWLMIKKRG 336 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 337 Length adjustment: 28 Effective length of query: 304 Effective length of database: 309 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory