Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_009140654.1 HMPREF9452_RS03120 amino acid ABC transporter ATP-binding protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_000225705.1:WP_009140654.1 Length = 251 Score = 108 bits (269), Expect = 1e-28 Identities = 68/216 (31%), Positives = 116/216 (53%), Gaps = 7/216 (3%) Query: 12 YGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLGDNPINMLSS 71 YG VL D++L++ G++ ++GP+G GKST+ +RL SG + + P+ Sbjct: 20 YGDLHVLKDINLTVHKGEVLVVVGPSGSGKSTMCRTVNRLETIDSGEILIEGEPLPQ-EG 78 Query: 72 RQLAR---RLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVAMNQTRI 128 R+L R L ++ Q +++ + V+ G + + G E AR + + + Sbjct: 79 RELTRMRAELGMVFQSFNLFAHMSILQNVTLGP---IEVLGMKKDEAEARAMELLARVGV 135 Query: 129 NHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMGELRTQG 188 A + +LSGGQ+QRA +A LA + ++ DEPT+ LD +++ +M EL G Sbjct: 136 AEQAAKSPAQLSGGQQQRAAIARSLAMHPKAMMFDEPTSALDPEMINEVLDVMVELARGG 195 Query: 189 KTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEE 224 T+V V H++N A R D++V MA+G ++ +GTP E Sbjct: 196 MTMVVVTHEMNFARRVADRVVFMADGQIVEEGTPAE 231 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 251 Length adjustment: 24 Effective length of query: 231 Effective length of database: 227 Effective search space: 52437 Effective search space used: 52437 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory