Align PTS system, IIA component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized)
to candidate WP_009140077.1 HMPREF9452_RS00200 PTS mannose transporter subunit IIAB
Query= TCDB::Q82ZC8 (150 letters) >NCBI__GCF_000225705.1:WP_009140077.1 Length = 326 Score = 73.2 bits (178), Expect = 4e-18 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 4/131 (3%) Query: 1 MLGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDG 60 M+GIVIA+HG L+ G K A +++ G N+ V+L + +I+ I + D Sbjct: 1 MVGIVIASHGELAPGIKQAGSMVFGDQPNVGAVSLMPSMGPDDIRAKIEECISSFDDQDQ 60 Query: 61 VLVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVLEAINHQLLGTPIAEAAQ 120 VL++ DL +P+NQA V++ E + +V+G NLPM++EA ++ E A Sbjct: 61 VLILADLWGGTPFNQASAVLDGHEDSWA----IVTGLNLPMLIEAYASRMSCESAQEVAV 116 Query: 121 AIVAQGKESVQ 131 A++ +E V+ Sbjct: 117 AVLKTAREGVR 127 Lambda K H 0.312 0.130 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 89 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 150 Length of database: 326 Length adjustment: 22 Effective length of query: 128 Effective length of database: 304 Effective search space: 38912 Effective search space used: 38912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory