GapMind for catabolism of small carbon sources

 

Alignments for a candidate for nagEIIA in Collinsella tanakaei YIT 12063

Align Putative phosphotransferase enzyme IIA component YpqE (characterized, see rationale)
to candidate WP_009141285.1 HMPREF9452_RS06255 PTS glucose transporter subunit IIA

Query= uniprot:P50829
         (168 letters)



>NCBI__GCF_000225705.1:WP_009141285.1
          Length = 165

 Score = 99.4 bits (246), Expect = 3e-26
 Identities = 47/129 (36%), Positives = 74/129 (57%)

Query: 19  VIYSPADGTVMDLSDVPDPVFSQKMMGEGIAVEPSSGEIVSPAEGEVIQIFHTKHAVGIR 78
           V+ +P +G V+ LS+V D  F+   +G+G+A+ P+   +++P   ++  IF T HAV  R
Sbjct: 17  VLRAPLEGDVIPLSEVNDETFAAGYLGQGVAIRPTGDRVIAPTAVKIEAIFPTGHAVAFR 76

Query: 79  TRSGIELLIHVGLETVNMNGEGFTAHIKEGDKVKVGDPLITCDLELIKEKASSTVIPIVI 138
           T  G+++LIHVGLET N+ G  F  H   GD V  G+ LI  D + I  +     +P++I
Sbjct: 77  TVDGLDVLIHVGLETYNLEGRHFKVHAAPGDMVTAGETLIEFDRQAIVNEGYDITVPVLI 136

Query: 139 MNGEAVGSM 147
            N     S+
Sbjct: 137 RNAVEFASI 145


Lambda     K      H
   0.314    0.134    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 70
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 168
Length of database: 165
Length adjustment: 18
Effective length of query: 150
Effective length of database: 147
Effective search space:    22050
Effective search space used:    22050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory