Align glycerol dehydrogenase (EC 1.1.1.6) (characterized)
to candidate WP_009140732.1 HMPREF9452_RS03515 iron-containing alcohol dehydrogenase family protein
Query= BRENDA::Q8ZKM9 (367 letters) >NCBI__GCF_000225705.1:WP_009140732.1 Length = 372 Score = 130 bits (326), Expect = 7e-35 Identities = 95/327 (29%), Positives = 165/327 (50%), Gaps = 16/327 (4%) Query: 34 VVGDKFVLGFAEETLRKSLTDAGLSVE-IAPFGGECSQNEIDRLRAVAEKSQCGAVLGIG 92 V+G + L A + L +L + +SV +GG+ + + ++ L + E ++ A+ +G Sbjct: 33 VIGGRKALTAASDRLTAALEGSDVSVTGTFWYGGKAAYSCVEELCSSPEVAEADAIFVVG 92 Query: 93 GGKTLDTAKALAHFMNVPVAIAPTIASTDAPCSALSVIYTDAGEFDRYLLLPHNPNMVIV 152 GGK +DT K +AH + P+ PTIAS +P S +S++Y + G F + L P + Sbjct: 93 GGKAVDTCKIVAHRLAKPLYTFPTIASNCSPVSCISIMYNEDGSFKEIVQLHEPPAHCFI 152 Query: 153 DTQIVAGAPARLLAAGIGDALATWFEARACSRSGATTMAGGKCTQAALALAELCYNTLIE 212 DTQ++A AP L AGIGD +A ++E R + + A++ +C LI+ Sbjct: 153 DTQVIAEAPEMYLWAGIGDTIAKYYEVVFSMRGDSPSYG----PVLGRAISCMCNRPLID 208 Query: 213 EGEKAMLAAEQHVVTPALE----RVIEANTYLSGVGFESGGLAAAHAIHNGLTAIPDAHH 268 +A + + V+ AL ++ + +SG+ A AHA+ GLT IP Sbjct: 209 CALEAYEDCKNNRVSDALTHAALNIVVSTGLVSGLVGVDYNSALAHALFYGLTTIPSIER 268 Query: 269 -YYHGEKVAFGTLTQLVLENAPVEEIETVAALCHSVGLPITLAQLDIK-QDIPAKMRTVA 326 + HGE V++G L QLV++ E+++ + L +GLP LA L + +D A+ Sbjct: 269 DHCHGEVVSYGVLVQLVMDK-DSEQLDFLMPLYRKLGLPTCLADLGLTVEDDFAEALAAT 327 Query: 327 EASCAEGETIHNMPGGATPDEVYAALL 353 E + + + ++P T D ++ A+L Sbjct: 328 EVN----QELRHVPYPVTRDLIWQAIL 350 Lambda K H 0.318 0.133 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 372 Length adjustment: 30 Effective length of query: 337 Effective length of database: 342 Effective search space: 115254 Effective search space used: 115254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory