Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate WP_009141551.1 HMPREF9452_RS07580 lactaldehyde reductase
Query= BRENDA::A4IP64 (395 letters) >NCBI__GCF_000225705.1:WP_009141551.1 Length = 386 Score = 206 bits (523), Expect = 1e-57 Identities = 128/360 (35%), Positives = 202/360 (56%), Gaps = 8/360 (2%) Query: 5 RIVFPPLSHVGWGALDQLVPEVKRLGAKHILVITDPMLVKIGLVDQVTSPLRQEGYSVHV 64 RIV +S+ G GA+ ++ E+ R G K + V TDP LVK G+ +VT L + G + V Sbjct: 4 RIVLNTISYHGAGAIQEIPGELTRRGYKKVFVCTDPDLVKFGVAAKVTDLLDEAGIAYSV 63 Query: 65 YTDVVPEPPLETGEKAVAFARDGKFDLVIGVGGGSALDLAKLAAVLAVHDGSVADYLNLT 124 Y+D+ P P ++ V + + D ++ +GGGSA+D AK V+ + + AD +L Sbjct: 64 YSDIKPNPTIQNVTDGVEAFKAAEADSIVTIGGGSAMDTAKAIGVI-ITNPEFADVRSLE 122 Query: 125 GTRTLEKKGLPKILIPTTSGTGSEVT-NISVLSLETTKDVVTHDYLLA-DVAIVDPQLTV 182 G + + I +PTT+GT +EVT N + +E + V D A +VA+VDP++ Sbjct: 123 GVAPTKNHAVFTIAVPTTAGTAAEVTINYVITDVEKVRKFVCVDTNDAPEVAVVDPEMMA 182 Query: 183 SVPPRVTAATGIDALTHAVEAYVSVNASPTSDGLAVAAIRLISRSLRKAVA---NGSDKQ 239 ++P +TA+TG+DALTHA+E Y + A SD + AI LIS++LR AVA +G Sbjct: 183 TMPAGLTASTGMDALTHAIEGYTTKGAWEMSDMFHLKAIELISKNLRDAVAEAKSGVPGS 242 Query: 240 ARIDMANGSYLAGLAFFNAGVAGVHALAYPLGGQFHIAHGESNAVLLPYVMGYIRQSCTK 299 R MA Y+AG+ F N G+ H++A+ L F HG + A+LLP M + + + Sbjct: 243 GREGMALAQYIAGMGFSNVGLGVDHSMAHTLSAHFDTPHGVACAMLLPIAMEFNKPVVIE 302 Query: 300 RMADIFNALGGNSSFLSEVEASYRCVEELERFVADVGIPKTLGGFGIPESALESLTKDAV 359 R+A + A+G +++ +S EA+ + +++ DV IP I E L++LTKDA+ Sbjct: 303 RLAKVAVAMGVDTTGMSTDEAADAAIAAVKQLSVDVNIPTVCE--AITEDELDTLTKDAM 360 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 386 Length adjustment: 31 Effective length of query: 364 Effective length of database: 355 Effective search space: 129220 Effective search space used: 129220 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory