Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate WP_009141743.1 HMPREF9452_RS08560 ATP-binding cassette domain-containing protein
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >NCBI__GCF_000225705.1:WP_009141743.1 Length = 267 Score = 128 bits (322), Expect = 2e-34 Identities = 89/238 (37%), Positives = 128/238 (53%), Gaps = 11/238 (4%) Query: 21 MSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVDGKDVTGM-PVR-DRNVAM 78 +SLA++ G + +LG + GKT+ ++++ L P GRV VDG +V + PV R + Sbjct: 29 VSLAVEPGELVCVLGTSGGGKTTFIKLINRLHDPDEGRVLVDGVNVAELDPVELRRRIGY 88 Query: 79 VYQQFINYPSMKVAANIAS-PLKLRGEKN-IDARVREIASRLHIDM--FLDRYPAELSGG 134 V QQ +P M VA NIA P L+ ++ IDARV E+ +H+D F DRYPA+LSGG Sbjct: 89 VIQQTGLFPHMTVAQNIACVPKILKWDRGRIDARVDELLRLVHLDPAEFADRYPAQLSGG 148 Query: 135 QQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTVVYATTEPGEA 194 QQQRV L RALA +MLLDEP +D R L++EL + T ++ T + EA Sbjct: 149 QQQRVGLVRALAAEPRIMLLDEPFGAIDALTRASLQDELLHIHRGSGKTFIFVTHDVAEA 208 Query: 195 LLLGGYTAVLDEGQLLQYGPTAEVFHAP-----NSLRVARAFSDPPMNLMAASATAQG 247 + L V+D G++ Q+ E+ P L + F P A A+ +G Sbjct: 209 MKLATKILVVDAGRVQQFASPDELAARPATPFVRELLATQGFLAPTGRDAAPKASQEG 266 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 267 Length adjustment: 27 Effective length of query: 336 Effective length of database: 240 Effective search space: 80640 Effective search space used: 80640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory