Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate WP_009140654.1 HMPREF9452_RS03120 amino acid ABC transporter ATP-binding protein
Query= TCDB::Q9HU32 (257 letters) >NCBI__GCF_000225705.1:WP_009140654.1 Length = 251 Score = 251 bits (642), Expect = 8e-72 Identities = 130/250 (52%), Positives = 175/250 (70%), Gaps = 11/250 (4%) Query: 6 PALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQIL 65 P +E+R++ K YGDL VLK I+LT G+V+ ++G SGSGKST R +N LE G+IL Sbjct: 9 PIIELRHVDKHYGDLHVLKDINLTVHKGEVLVVVGPSGSGKSTMCRTVNRLETIDSGEIL 68 Query: 66 VSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVLGK 125 + GE L + +++ R+R+ELG VFQ+FNL+ HMSIL NV P VLG Sbjct: 69 IEGEPL-----------PQEGRELTRMRAELGMVFQSFNLFAHMSILQNVTLGPIEVLGM 117 Query: 126 SKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSALD 185 K EA A LLA+VG+A++ PAQLSGGQQQRAAIAR+LAM PK ++FDEPTSALD Sbjct: 118 KKDEAEARAMELLARVGVAEQAAKSPAQLSGGQQQRAAIARSLAMHPKAMMFDEPTSALD 177 Query: 186 PEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFENPQ 245 PEM+ EVL+V+ LA G TM++VTHEM+FAR+V+ VVF+ G + E+GTP + F++P+ Sbjct: 178 PEMINEVLDVMVELARGGMTMVVVTHEMNFARRVADRVVFMADGQIVEEGTPAEFFDHPK 237 Query: 246 SARCKQFMSS 255 + R + F+ S Sbjct: 238 TQRARDFLDS 247 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 251 Length adjustment: 24 Effective length of query: 233 Effective length of database: 227 Effective search space: 52891 Effective search space used: 52891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory