Align ABC transporter for Lactose, ATPase component (characterized)
to candidate WP_009140654.1 HMPREF9452_RS03120 amino acid ABC transporter ATP-binding protein
Query= reanno::Smeli:SM_b20002 (358 letters) >NCBI__GCF_000225705.1:WP_009140654.1 Length = 251 Score = 145 bits (367), Expect = 8e-40 Identities = 86/243 (35%), Positives = 135/243 (55%), Gaps = 12/243 (4%) Query: 4 LQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDLTID 63 ++L V K YG L V+K ++L + GE +V VGPSG GKST+ R + LE I SG++ I+ Sbjct: 11 IELRHVDKHYGDLHVLKDINLTVHKGEVLVVVGPSGSGKSTMCRTVNRLETIDSGEILIE 70 Query: 64 DVRM----NDVDPSKRGIAMVFQSYALYPHMTVRENMGFA-LRFAGVPRAEIEKRVNEAA 118 + ++ + + MVFQS+ L+ HM++ +N+ + G+ + E E R E Sbjct: 71 GEPLPQEGRELTRMRAELGMVFQSFNLFAHMSILQNVTLGPIEVLGMKKDEAEARAMELL 130 Query: 119 HILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAEL---RVHMRIE 175 + + + P QLSGGQ+QR AI R++ HPK +FDEP S LD E+ + + +E Sbjct: 131 ARVGVAEQAAKSPAQLSGGQQQRAAIARSLAMHPKAMMFDEPTSALDPEMINEVLDVMVE 190 Query: 176 IARLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIG 235 +AR T+V VTH+ A +AD++V M G + + G+P + +D P F+ Sbjct: 191 LAR----GGMTMVVVTHEMNFARRVADRVVFMADGQIVEEGTPAEFFDHPKTQRARDFLD 246 Query: 236 SPK 238 S K Sbjct: 247 SIK 249 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 251 Length adjustment: 27 Effective length of query: 331 Effective length of database: 224 Effective search space: 74144 Effective search space used: 74144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory