Align lysine racemase (EC 5.1.1.5) (characterized)
to candidate WP_009141067.1 HMPREF9452_RS05125 alanine racemase
Query= BRENDA::Q04HB7 (371 letters) >NCBI__GCF_000225705.1:WP_009141067.1 Length = 383 Score = 162 bits (411), Expect = 1e-44 Identities = 119/383 (31%), Positives = 193/383 (50%), Gaps = 36/383 (9%) Query: 11 IEFSKSSLAYNVQYTKQVSG-AKTLWLAVKSNAYGHGLLQVSKIARECGVDGLAVSVLDE 69 +E + +L N + K + G K L VK++AYGHG +Q +KI G D AV+ + E Sbjct: 14 VEIDQGALRRNTRAFKNLLGYGKRLCCVVKADAYGHGAVQCAKIMHATGADMFAVATVSE 73 Query: 70 GIAIRQAGIDDFILILGPIDVKYAPIASKYHFLTTVSSLDWLKSADK------ILGKEKL 123 G+ +R+ GI IL+L + +Y + +V S ++ + + +GK Sbjct: 74 GVQLREGGIKSPILVLNEPPIDACDTLLEYQIMPSVYSSEFALAYGERAVEMGCVGK--- 130 Query: 124 SVNLAVDTGMNRIGVRSKKDLKDEIEFLQEHSDH--FSYDGIFTHFASSDNPDDHYFQRQ 181 ++A++TGMNRIGVR D +EF +E H DG+FTHFA++D+PD ++ Q Sbjct: 131 -YHMAIETGMNRIGVR----FTDVLEFRREIDFHRGIECDGVFTHFATADDPDGWDYRLQ 185 Query: 182 KNRWYELI----DGLIMPRYVHVMNSGAAMY-HSKELPGCNSIARVGTVVYGVEPSEGVL 236 R+ E + D VH N+ A+M HS + + R G +YG++P E Sbjct: 186 CTRFSEAVAAMKDAGFECGIVHCSNTPASMLDHSMQF----DMIRAGIGLYGLQPCE-KS 240 Query: 237 GPIDKLKPVFELKSALTFVKKIPAGEGISYGSKF-VTSRDTWIGTLPIGYGDGWLAEYQD 295 PI L+PV +++ +T GEG+ YG F V + T+P+GY DG + Sbjct: 241 APIMPLEPVMSVRARVTRTIHPAMGEGVGYGFTFRVPRARVQVCTIPVGYADGLPRTLSN 300 Query: 296 -FQLLIDGQKCRQVGQIAMDQMMVALPH-------EYPIGTEVTLIGKSGKYENTLYDLH 347 +L GQ+ RQVG I MDQ MVA+ E +G +T++GK G ++ ++ Sbjct: 301 KMDVLYRGQRIRQVGNICMDQCMVAIQQTPARQMPEAEVGDLITIVGKDGDAVISMDEMA 360 Query: 348 KHSGVPPWKITVAFSDRLKRMVV 370 + G +++ F RL+++ + Sbjct: 361 RLRGTINYEVACGFGMRLEKVYI 383 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 383 Length adjustment: 30 Effective length of query: 341 Effective length of database: 353 Effective search space: 120373 Effective search space used: 120373 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory