Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate WP_009140654.1 HMPREF9452_RS03120 amino acid ABC transporter ATP-binding protein
Query= SwissProt::P19566 (369 letters) >NCBI__GCF_000225705.1:WP_009140654.1 Length = 251 Score = 157 bits (397), Expect = 3e-43 Identities = 89/240 (37%), Positives = 141/240 (58%), Gaps = 6/240 (2%) Query: 4 VQLRNVTKAWGDVVVSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFI- 62 ++LR+V K +GD+ V KDINL +H GE +V VGPSG GKST+ R + LETI SG++ I Sbjct: 11 IELRHVDKHYGDLHVLKDINLTVHKGEVLVVVGPSGSGKSTMCRTVNRLETIDSGEILIE 70 Query: 63 GE---TRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFG-LKLAGAKKEVMNQRVNQVA 118 GE ++ +GMVFQS+ L+ H+S+ +N++ G +++ G KK+ R ++ Sbjct: 71 GEPLPQEGRELTRMRAELGMVFQSFNLFAHMSILQNVTLGPIEVLGMKKDEAEARAMELL 130 Query: 119 EVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISR 178 + +A + P LSGGQ+QR AI R+L P+ + DEP S LD + + +++ Sbjct: 131 ARVGVAEQAAKSPAQLSGGQQQRAAIARSLAMHPKAMMFDEPTSALDPEM-INEVLDVMV 189 Query: 179 LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPK 238 R G TM+ VTH+ A +AD++V + G++ + G P E + +P + F+ S K Sbjct: 190 ELARGGMTMVVVTHEMNFARRVADRVVFMADGQIVEEGTPAEFFDHPKTQRARDFLDSIK 249 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 251 Length adjustment: 27 Effective length of query: 342 Effective length of database: 224 Effective search space: 76608 Effective search space used: 76608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory