Align L-fuconate dehydratase; L-rhamnonate dehydratase (EC 4.2.1.68; EC 4.2.1.90) (characterized)
to candidate WP_009140717.1 HMPREF9452_RS03440 altronate dehydratase
Query= reanno::BFirm:BPHYT_RS34230 (431 letters) >NCBI__GCF_000225705.1:WP_009140717.1 Length = 494 Score = 163 bits (413), Expect = 1e-44 Identities = 125/407 (30%), Positives = 185/407 (45%), Gaps = 35/407 (8%) Query: 4 AAQQPTLEGYLRGDGRKGIRNVVAVAYLVECAHHVAREIVTQFREPLDAFDDPSAEREPP 63 A + T +G+ R DGR RN + + V C + VAR + Q + D + Sbjct: 102 AIEPKTFQGFRRADGRAATRNELWIIPTVGCVNEVARAMCEQAQ-------DLVGDSLEG 154 Query: 64 VHLIGFP-GCYPNG----YAEKMLERLTTHPNVGAVLFVSLGCESM-NKHYLVDVVRASG 117 V+ P GC G K+L L+ H N VLF+SLGCE+ + L ++ Sbjct: 155 VYYFPHPFGCSQTGADHAQTRKLLVALSRHANAAGVLFLSLGCENCTHDQVLEELGNYDA 214 Query: 118 RPVEVLTIQEKGGTRSTIQYGVDWIRGAREQLAAQQKVPMALSELVIGTICGGSDGTSGI 177 + V LT Q+ + G + ++ ++ SEL IG CGGSDG SGI Sbjct: 215 QRVRFLTCQD---VEDELVEGHKILSELATHAKTFKRETISASELAIGLKCGGSDGLSGI 271 Query: 178 TANPAVGRAFDHLIDAGATCIFEETGELVGCEFHMKTRAARPALGDEIVACVAKAARYYS 237 TANP +GR D + G T + E E+ G E + R + D + Y+ Sbjct: 272 TANPVIGRVSDIAVAGGGTSVLTEVPEMFGAESILLDRCEGQDVFDAAADMLNGFKDYF- 330 Query: 238 ILGHGSF-----AVGNADGGLTTQEEKSLGAYAKSGASPIVGIIKPGDIPPTGGLYLLDV 292 + HG + GN DGG+TT E+KS G K G +PIV ++ GD GL +L Sbjct: 331 -ISHGEVVYENPSPGNKDGGITTLEDKSCGCVQKGGDAPIVDVLGYGDTVRKPGLQML-C 388 Query: 293 VPDGEPRFGFPNISDNAEIGELIACGAHVILFTTGRGSVVGSAISPVIKVCANPATYRNL 352 P +D L A G HVILF+TGRG+ G A +P +KV N ++ Sbjct: 389 CPG----------NDMVSTTALTAAGCHVILFSTGRGTPFG-APAPTLKVFTNERLCQHK 437 Query: 353 SGDMDVDAGRILEGRGTLDEVGREVFEQTVAVSRGAASKSETLGHQE 399 + MD +AG + G T+DE ++++ + + G + +E G E Sbjct: 438 ANWMDFNAGVVATGERTIDEAAEDLWDLVLETASGRQTSAERRGCHE 484 Lambda K H 0.318 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 638 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 494 Length adjustment: 33 Effective length of query: 398 Effective length of database: 461 Effective search space: 183478 Effective search space used: 183478 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory