Align ABC transporter (characterized, see rationale)
to candidate WP_009140654.1 HMPREF9452_RS03120 amino acid ABC transporter ATP-binding protein
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_000225705.1:WP_009140654.1 Length = 251 Score = 148 bits (374), Expect = 1e-40 Identities = 80/238 (33%), Positives = 141/238 (59%), Gaps = 6/238 (2%) Query: 4 LKLDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLID 63 ++L +V+K G + +L+D++L + GE +V VGPSG GKST+ R + L++I G++LI+ Sbjct: 11 IELRHVDKHYGDLHVLKDINLTVHKGEVLVVVGPSGSGKSTMCRTVNRLETIDSGEILIE 70 Query: 64 GRRV----NDLEPRERGVGMVFQSYALYPHMSVYDNISFG-LKLAKTDKTSLRERVLKTA 118 G + +L +GMVFQS+ L+ HMS+ N++ G +++ K R ++ Sbjct: 71 GEPLPQEGRELTRMRAELGMVFQSFNLFAHMSILQNVTLGPIEVLGMKKDEAEARAMELL 130 Query: 119 QILQLDKLLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIAR 178 + + + + P +LSGGQ+QR A+ R++A P ++FDEP S LD + ++ + + Sbjct: 131 ARVGVAEQAAKSPAQLSGGQQQRAAIARSLAMHPKAMMFDEPTSALDPEMINEVLDVMVE 190 Query: 179 LHDRLGSTMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGS 236 L R G TM+ VTH+ A +AD++V + G++ + G+P E ++ P ++ FL S Sbjct: 191 L-ARGGMTMVVVTHEMNFARRVADRVVFMADGQIVEEGTPAEFFDHPKTQRARDFLDS 247 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 251 Length adjustment: 27 Effective length of query: 354 Effective length of database: 224 Effective search space: 79296 Effective search space used: 79296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory