Align 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) (characterized)
to candidate WP_009140831.1 HMPREF9452_RS04005 NAD-binding protein
Query= reanno::psRCH2:GFF2390 (296 letters) >NCBI__GCF_000225705.1:WP_009140831.1 Length = 360 Score = 160 bits (404), Expect = 5e-44 Identities = 102/295 (34%), Positives = 153/295 (51%), Gaps = 8/295 (2%) Query: 1 MHIGFIGLGNMGAPMAHNLLKAGHQLSVFDLNAAAVENLVGAGALPVDSPTAIAQGNAEL 60 + + FIG G MGAP+A ++L AG+ + VF + L+ GA +S A + +A++ Sbjct: 6 LSVAFIGTGIMGAPIAGHILDAGYSVRVFTRTKSKAAGLIERGAAWAESAEAAVE-DADV 64 Query: 61 IITMLPAAAHVKGVYLGVNGLIAHSRAGVMLIDCSTIDPHSAREVAKAAAEHGNPMLDAP 120 + TM+ V+ +YL +GL+A S+ G LID +T P AR++A+AA G D P Sbjct: 65 VFTMVGYPQEVEEIYLAGDGLLATSKPGAYLIDLTTSSPELARDIAEAAEVSGRHAFDCP 124 Query: 121 VSGGTGGAAAGTLTFMVGGSDPDFDHAQPILAAMGKNIVHCGAAGNGQVAKVANNMLLGI 180 V+GG GA AGTLT + G ++ D + + +L NI G AG GQ AK+AN + L Sbjct: 125 VTGGESGAIAGTLTLIAGATERDIEPVREVLECFSSNIFCFGGAGKGQAAKLANQVALAS 184 Query: 181 SMIGVAEAMALGVALGMDAKTLAGVINTSSGRCWSSDTYNPFPGVLDNVPSSRGYSGGFG 240 SM+G+A+AMA G+D + +I +G+ + + P LD Y GF Sbjct: 185 SMVGMADAMAFAQQSGLDLEQTRQMICGGTGKSGAMEQL--APKALDG-----DYKPGFM 237 Query: 241 SDLMLKDLGLATEAAKQVRQPVILGALAQQLYQSFSAQGHGGLDFSAIINQYRKD 295 LKDLGLA + A++ + A LY A G L AI Y+++ Sbjct: 238 VQHFLKDLGLALQVAEEKEIALPGCDTAFTLYDMLDAIGGARLGTQAITLLYQEE 292 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 360 Length adjustment: 28 Effective length of query: 268 Effective length of database: 332 Effective search space: 88976 Effective search space used: 88976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory