Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate WP_010538506.1 KCY_RS0118670 L-fucose:H+ symporter permease
Query= uniprot:A0A1I2JXG1 (442 letters) >NCBI__GCF_000226135.1:WP_010538506.1 Length = 438 Score = 192 bits (488), Expect = 2e-53 Identities = 129/418 (30%), Positives = 220/418 (52%), Gaps = 31/418 (7%) Query: 31 VLTSIFFMWGFLTCLNDILIPHLKA---VFKLNYAEAMLVQFTFFGAYFLMSLPAGLLVA 87 ++TS F +WGF NDI P +KA +F+++ + LVQ F+G YF M+ PA + + Sbjct: 22 LITSCFALWGF---ANDITNPMVKAFSKIFRMSATDGALVQVAFYGGYFAMAFPAAMFIR 78 Query: 88 RLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYVALLG 147 + YK G++ GL + GA F+PA Y FL A F+L G++ L+ + N Y+ +G Sbjct: 79 KYSYKAGVLLGLGLYAFGAFLFFPAKMTGEYYPFLIAYFILTCGLSFLETSCNPYILSMG 138 Query: 148 PEKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAV--LSAEQIAKLSPAEQVAYRVQEA 205 E++A+ RL LAQ+ N +G+ L F + + A + + ++ A L+ +E A + + Sbjct: 139 TEETATRRLNLAQSFNPMGSLLG-MFVAMQFIQAKLHPMGTDERALLNESEFQAIKESDL 197 Query: 206 QTVQGPYLGLAIVLFLLAVFVYLFRLPALTEKTEQ----ASVKQHSLVSPLRHPHVLFGV 261 + PYL + IV+ + + + ++P ++ + ++K+ ++ R GV Sbjct: 198 AVLIAPYLTIGIVILAMLLLIRFVKMPKNGDQNHKIDFFPTLKRIFTLTRYRE-----GV 252 Query: 262 LAIFFYVGGEVAIGSFLVNY---LSMPDIGNMSEQAAANWVAYYWLGAM----IGRFIGS 314 +A FFYVG ++ +F++ Y L M M E++A Y + AM I RFI + Sbjct: 253 IAQFFYVGVQIMCWTFIIQYGTRLFMSPEYGMDEKSAEVLSQQYNIIAMVIFCISRFICT 312 Query: 315 ALLAKLSPRKLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERM 374 +L L+ KLL I A L T+ + +Y +V++ S+MFPTI+ + ++ M Sbjct: 313 FILRYLNAGKLLMILAIFGGIFTLGTIFLQNIFGLYCLVAVSACMSLMFPTIYGIALKGM 372 Query: 375 GPMTGEASSLLIMAIVGGAIVPFVQGLFAD--HIG----VQHAFFLPLLCYAYIVFYG 426 G ++ LIMAI+GG+++P +Q D IG V +F LP +C+ I+ YG Sbjct: 373 GDDAKFGAAGLIMAILGGSVLPPLQASIIDMKEIGSMPAVNVSFILPFICFLVIIGYG 430 Lambda K H 0.327 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 438 Length adjustment: 32 Effective length of query: 410 Effective length of database: 406 Effective search space: 166460 Effective search space used: 166460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory