Align Sorbitol (glucitol):H+ co-transporter, SOT2 (Km for sorbitol of 0.81 mM) of 491 aas and 12 TMSs (Gao et al. 2003). SOT2 of Prunus cerasus is mainly expressed only early in fruit development and not in leaves (characterized)
to candidate WP_010536987.1 KCY_RS0109365 sugar porter family MFS transporter
Query= TCDB::AGG19156.1 (491 letters) >NCBI__GCF_000226135.1:WP_010536987.1 Length = 460 Score = 210 bits (535), Expect = 7e-59 Identities = 153/470 (32%), Positives = 233/470 (49%), Gaps = 51/470 (10%) Query: 1 MTSILLGYDIGVMSGAAIYIEKDLKVTD--TQIEILLGILNLYSLIGSAMAGRTSDWVGR 58 M +L GYD V+ GA + E + D T + + + L LIG+ +AG +D GR Sbjct: 18 MGGLLFGYDWVVIGGAKPFYELYFDIADSPTMQGLAMSVALLGCLIGAMVAGMMADRYGR 77 Query: 59 RYTIVISGAIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGF 118 + ++IS IF + A G + +++ + RF+ G+G+G A ++P+Y AEV+P S RG Sbjct: 78 KPLLLISAFIFLSSAYATGAFSVFSWFLVARFLGGIGIGIASGLSPMYIAEVAPTSIRGK 137 Query: 119 LTSFPEVFVNVGILLGYISNYAFS-----------FCAL---DLGWRLMLGVGAIPSVIL 164 L S ++ + +GIL I+N+ + CA +GWR M A P+ + Sbjct: 138 LVSLNQLTIVLGILGAQIANWLIAEPIPADFTPADICASWNGQMGWRWMFWGAAFPAAVF 197 Query: 165 AIGVLAMPESPRWLVMQGRLGDARQVLDKTSDSK-EESMLRLADIKEAAGIPEDCNDDIV 223 + +PESPRWL M+G+ A VL K + E L++ V Sbjct: 198 LLLACFIPESPRWLAMKGKRERAWNVLSKIGGNHYAEQELQM-----------------V 240 Query: 224 QVTGHSHGEGVWKELFVHP--TPTVLHILIAALGFHFFQQASGIDALVLYSPRVFEKAGI 281 + TG S EG K LF P VL I++A FQQ G + + Y+ +F+ AG Sbjct: 241 EQTGSSKSEGGLKLLFSRPFRKVLVLGIIVAV-----FQQWCGTNVIFNYAQEIFQSAGY 295 Query: 282 TSSDQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQ 341 + D +L V G++ +FT VA + ++R+GRR L+L G+ + LGT Q Sbjct: 296 SLGD-VLFNIVVTGVANVIFTFVAIYTVERLGRRVLMLLGAGGLAGIYLVLGTCYFF--Q 352 Query: 342 HEGARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMS 401 G M VVL + C ++ +GPI WV +EIFP R+R V S Sbjct: 353 VSGFFMVVLVVLAIAC-------YAMSLGPITWVLLAEIFPNRVRGVAMATCTFALWVGS 405 Query: 402 GILSMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDME 451 L+ TF L A+ G F++Y+AI VG++FF LPET+G++LE +E Sbjct: 406 FTLTYTFPLLNSALGSYGTFWIYSAICLVGFVFFRRALPETKGKSLETLE 455 Lambda K H 0.326 0.141 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 683 Number of extensions: 39 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 491 Length of database: 460 Length adjustment: 33 Effective length of query: 458 Effective length of database: 427 Effective search space: 195566 Effective search space used: 195566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory