Align Facilitated trehalose transporter Tret1-2 homolog; DmTret1-2 (characterized)
to candidate WP_010536987.1 KCY_RS0109365 sugar porter family MFS transporter
Query= SwissProt::Q8MKK4 (488 letters) >NCBI__GCF_000226135.1:WP_010536987.1 Length = 460 Score = 190 bits (483), Expect = 8e-53 Identities = 127/414 (30%), Positives = 200/414 (48%), Gaps = 36/414 (8%) Query: 80 LAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIA 139 L L G + G + + GR+ +L +A F+ S+ L RFL G +GIA Sbjct: 59 LGCLIGAMVAGMMADRYGRKPLLLISAFIFLSSAYATGAFSVFSWFLVARFLGGIGIGIA 118 Query: 140 SLSLPVYLGETLQPEVRGTLGLLPTALGNIGIL---------------------VCYVAG 178 S P+Y+ E +RG L L +GIL +C Sbjct: 119 SGLSPMYIAEVAPTSIRGKLVSLNQLTIVLGILGAQIANWLIAEPIPADFTPADICASWN 178 Query: 179 SFMNWSMLAFLGAALPVP-FLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPE 237 M W + F GAA P FL+L IPE+PRW +G+ ERA L + G E E Sbjct: 179 GQMGWRWM-FWGAAFPAAVFLLLACFIPESPRWLAMKGKRERAWNVLSKIGGNHY-AEQE 236 Query: 238 LKELMQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKD 297 L+ + Q+ + + LF R K L + + + FQQ+ G N + Y +IF+ Sbjct: 237 LQMVEQTGSSKSEGGLKL----LFSRPFRKVLVLGIIVAVFQQWCGTNVIFNYAQEIFQS 292 Query: 298 AGSTIDSNLSTIIV-GVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCK 356 AG ++ L I+V GV N TF+ I ++RLGR++L+ + + +LG ++ + Sbjct: 293 AGYSLGDVLFNIVVTGVANVIFTFVAIYTVERLGRRVLMLLGAGGLAGIYLVLGTCYFFQ 352 Query: 357 AHGPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCT 416 G + + V+ I +++ GPI W+++ EI P ++RG A + T W + Sbjct: 353 VSG-------FFMVVLVVLAIACYAMSLGPITWVLLAEIFPNRVRGVAMATCTFALWVGS 405 Query: 417 FVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIERKMM 470 F +T TF L A+G++G FW++ AIC+VG F +PET+GKSLE +E+ ++ Sbjct: 406 FTLTYTFPLLNSALGSYGTFWIYSAICLVGFVFFRRALPETKGKSLETLEKDLI 459 Lambda K H 0.328 0.142 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 661 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 460 Length adjustment: 33 Effective length of query: 455 Effective length of database: 427 Effective search space: 194285 Effective search space used: 194285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory