Align D-lactate transporter, ATP-binding component (characterized)
to candidate WP_007511585.1 R2APBS1_RS15240 LPS export ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >NCBI__GCF_000230695.2:WP_007511585.1 Length = 239 Score = 127 bits (318), Expect = 3e-34 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 12/246 (4%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 +L + + K F Q + D S+RE V ++GPNGAGK+T +VG + D G++ Sbjct: 1 MLSAEGLQKSFKSRQVVKDFGFSIREGEVVGLLGPNGAGKTTCFYMVVGLIEADGGTIKL 60 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQ 122 D + G + ++GI + Q +F LSV +N+M RDG + Q Sbjct: 61 DKLDITGAPMHARAKLGIGYLPQEASVFRRLSVADNIM-AVLELRDG--------LTASQ 111 Query: 123 RDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARA 182 RD + E++L+E+ +A S+S G++RR+EI L+ PR +LLDEP AG+ Sbjct: 112 RD--AELENLLDELKIAHIAGQKGISLSGGERRRVEIARALAANPRYMLLDEPFAGVDPI 169 Query: 183 DTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKV 242 +++ +K ER I + I +H++ + DR +L +G L P +I + KV Sbjct: 170 SVGEIQRIVRHLK-ERGIGVLITDHNVRETLGICDRAYILNEGEVLSRGTPAHILADEKV 228 Query: 243 REAYLG 248 RE YLG Sbjct: 229 REVYLG 234 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 239 Length adjustment: 24 Effective length of query: 227 Effective length of database: 215 Effective search space: 48805 Effective search space used: 48805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory